BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309G04f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.06 |rpl902|rpl9-2|60S ribosomal protein L9|Schizosacchar... 120 1e-28 SPAC4G9.16c |rpl901|rpl9-1|60S ribosomal protein L9|Schizosaccha... 116 2e-27 SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 29 0.32 SPBC14C8.16c |bot1||mitochondrial ribosomal protein subunit S35 ... 27 2.2 SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharom... 26 3.9 SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 5.2 SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 25 6.8 SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 6.8 SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharo... 25 9.0 >SPCC613.06 |rpl902|rpl9-2|60S ribosomal protein L9|Schizosaccharomyces pombe|chr 3|||Manual Length = 189 Score = 120 bits (289), Expect = 1e-28 Identities = 55/113 (48%), Positives = 80/113 (70%) Frame = +3 Query: 183 KQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFGS 362 + I ++ + IP+G++V +K+RLVTVKGPRGVLK+N + + ++++ +K W GS Sbjct: 3 RDIYKDETLTIPEGVSVDIKARLVTVKGPRGVLKQNLRRVDIELKKQG-NTIKFIVWHGS 61 Query: 363 KKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRN 521 +K A +RT S + NMI GVT+GF+YKMR VYAHFPIN TE +++EIRN Sbjct: 62 RKHNACIRTAYSIINNMIIGVTQGFRYKMRLVYAHFPININLTENGTVVEIRN 114 >SPAC4G9.16c |rpl901|rpl9-1|60S ribosomal protein L9|Schizosaccharomyces pombe|chr 1|||Manual Length = 190 Score = 116 bits (280), Expect = 2e-27 Identities = 54/113 (47%), Positives = 78/113 (69%) Frame = +3 Query: 183 KQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFGS 362 + I ++ + IP G+TV +K+R VTV GPRG LK+N +H+ ++++ +K W GS Sbjct: 3 RDIYKDETLTIPKGVTVDIKARNVTVTGPRGTLKQNLRHVDIEMKKQG-NTIKFIVWHGS 61 Query: 363 KKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRN 521 +K A +R+V S + NMI GVT+GF+YKMR VYAHFPIN TE +++EIRN Sbjct: 62 RKHNACIRSVYSIINNMIIGVTQGFRYKMRLVYAHFPININLTENGTVVEIRN 114 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 29.5 bits (63), Expect = 0.32 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Frame = +3 Query: 210 KIPDGLTVHVKSRLVTV---KGP-RGVLKRNFKHLAVDIRMVNPRLLKVEKWFGSKKELA 377 K+PDG+ + SRL K P L F H +VD+ + L + E WF Sbjct: 1564 KVPDGIFLKT-SRLPIFEANKAPYNAYLLDFFTHGSVDMLIEQNNLKQSEIWFVLNDFSL 1622 Query: 378 AVRTVCSHVENMIKGVT 428 + T+CS + N++ VT Sbjct: 1623 VLATICSCLGNLLNLVT 1639 >SPBC14C8.16c |bot1||mitochondrial ribosomal protein subunit S35 |Schizosaccharomyces pombe|chr 2|||Manual Length = 315 Score = 26.6 bits (56), Expect = 2.2 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = -3 Query: 183 SCLGLKTRASMKHNLTDVYQIFRHFFSIYY*NISYNAFQVVKHNLKNNCGEFSLCRMRDL 4 S LGLKT ++ N T + + FFS + + KH KN ++ C R + Sbjct: 8 SQLGLKTAFNLSQNKTYTSAVKKQFFSTGAFLSNGGNIDLNKHTQKNIDSKYVACNSRSV 67 >SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 1462 Score = 25.8 bits (54), Expect = 3.9 Identities = 14/63 (22%), Positives = 35/63 (55%) Frame = +3 Query: 243 SRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFGSKKELAAVRTVCSHVENMIKG 422 S+L + + ++ RN + L++ ++VN +E W G + +AV T + ++++ + Sbjct: 1111 SKLCNLLNDKNIVVRN-QSLSLFHQLVNKYPFLLESWIGLQLVQSAVNTNTADIDDLYRL 1169 Query: 423 VTK 431 ++K Sbjct: 1170 LSK 1172 >SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 25.4 bits (53), Expect = 5.2 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 376 ASSFLDPNHFSTFRRRGFTMRMSTAKC-LKFLLRTPRG 266 A SFL+P STF R F+ +S C + LR+P G Sbjct: 341 AQSFLEPQTRSTFLRYLFSDEVSVKVCHVLKELRSPTG 378 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 25.0 bits (52), Expect = 6.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 386 PHGGKLLFGSEPFLNLQETRVYHANVNSQVFKVPFENSAGP 264 PH GK S +N E+R A+V+S + PF GP Sbjct: 127 PHAGKAA-QSAHVMNSTESRPSSAHVSSSYTQKPFAFPLGP 166 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 25.0 bits (52), Expect = 6.8 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -1 Query: 392 DCPHGGKLLFGSEPFLNLQETRVYHANVNSQVFKVPFENSAGPFNCHQT 246 D P+G GS F+ V+H+N N+ + +N N H + Sbjct: 386 DFPYGNSYGNGSSHFIANYGGSVHHSNENTMQSDLQHQNGNNAVNHHHS 434 >SPAC630.05 |gyp7||GTPase activating protein Gyp7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 134 SVRLCFILALVFRP 175 SVRLC I +++FRP Sbjct: 118 SVRLCSIYSIIFRP 131 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,189,751 Number of Sequences: 5004 Number of extensions: 44620 Number of successful extensions: 129 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -