BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309G04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0566 - 18583624-18583710,18584445-18584567,18584682-18585044 143 9e-35 02_01_0029 - 176002-176137,176495-176646,177166-177577,178010-17... 136 1e-32 03_06_0712 - 35683814-35684065,35685296-35685466 27 6.9 07_03_1082 - 23834840-23835928,23836879-23836974,23837739-23837930 27 9.1 >09_04_0566 - 18583624-18583710,18584445-18584567,18584682-18585044 Length = 190 Score = 143 bits (346), Expect = 9e-35 Identities = 64/115 (55%), Positives = 91/115 (79%), Gaps = 1/115 (0%) Frame = +3 Query: 180 MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP-RLLKVEKWF 356 MK I+A++ ++IP+G+TV V +++VTV+GPRG L RNFKHL +D +++ R L+V+ WF Sbjct: 1 MKTILASETMEIPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEGGRKLQVDAWF 60 Query: 357 GSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRN 521 G+++ +AA+RT SHV+N+I GVTKG++YKMR VYAHFPIN T N+ IEIRN Sbjct: 61 GTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRN 115 >02_01_0029 - 176002-176137,176495-176646,177166-177577,178010-178126, 178260-178322,178964-179167,180605-180687,182394-182516, 182987-183328 Length = 543 Score = 136 bits (328), Expect = 1e-32 Identities = 61/108 (56%), Positives = 84/108 (77%), Gaps = 3/108 (2%) Frame = +3 Query: 207 VKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP---RLLKVEKWFGSKKELA 377 ++IP G+TVHV +++VTV+GPRG L RNFKHL +D +++ R L+V+ WFG+++ +A Sbjct: 1 MEIPSGVTVHVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEVEGVRKLQVDAWFGTRRTMA 60 Query: 378 AVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRN 521 A+RT SHV+N+I GVTKG++YKMR VYAHFPIN T N+ IEIRN Sbjct: 61 AIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRN 108 >03_06_0712 - 35683814-35684065,35685296-35685466 Length = 140 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +3 Query: 276 VLKRNF-KHLAVDIRMVNPRLLKVE 347 VLKR+F + AVD+R +NP++ K E Sbjct: 5 VLKRHFSRKRAVDVRRINPKVPKEE 29 >07_03_1082 - 23834840-23835928,23836879-23836974,23837739-23837930 Length = 458 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +3 Query: 240 KSRLVTVKGPRGVLKRNFKH-LAVDIRMVNPRLLKVEKWFGSKKELAAVRTVCSHVENMI 416 K ++ GP G +K K+ + +NPRL K+ + KKEL V S+V M+ Sbjct: 143 KDEVLYKAGPFGTVKAIRKNPTVIPDESINPRLAKILQQVAIKKEL-IVALANSNVREML 201 Query: 417 K 419 + Sbjct: 202 E 202 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,662,905 Number of Sequences: 37544 Number of extensions: 274971 Number of successful extensions: 541 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -