BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309G03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 28 0.97 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 26 3.9 SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 5.2 SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 25 9.0 SPBC354.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 9.0 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 25 9.0 SPBC2D10.08c |||mitochondrial ribosomal protein subunit Yml6|Sch... 25 9.0 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 27.9 bits (59), Expect = 0.97 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 328 DAVSGIGTDEEAIIEILCTLSNYGIRTISAFYEQLYGKSLESD 456 DA++ + +E I E T +Y IRT+S Y+ Y S D Sbjct: 215 DAITSLWDPQELICERSITRMDYPIRTLSFSYDSRYLASGSED 257 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 25.8 bits (54), Expect = 3.9 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 417 ILRTTVRQEPGIGLKRRHVG 476 ++ T + +PG LK+RH+G Sbjct: 1171 MMPTNIEHDPGCTLKKRHIG 1190 >SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 25.4 bits (53), Expect = 5.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +3 Query: 408 HIRILRTTVRQEPGIGLKR-----RHVGTLQEIVRVVVHGXSR 521 H++ ++ V QE G L R LQE+VRVV+H R Sbjct: 325 HLQSIKAQVEQERGSRLGRLQELRNSFQQLQELVRVVLHENGR 367 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 285 CDDDIFQVAGEFTLEFANQVLAIVSLEGL 199 C D+ + G FTLE AN+ + + L G+ Sbjct: 552 CFVDLLRNCGAFTLEEANEYINLGILNGM 580 >SPBC354.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 163 Score = 24.6 bits (51), Expect = 9.0 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 175 IVQRLEIAETFKTNYGKD-LISELKS-ELTGNLENVIVALMTPLPH 306 +V R+E+ +F ++ + L+S ++ NL V + ++TPLPH Sbjct: 60 VVNRIELMTSFDFDHVQQILLSAVQPYPYDKNLMFVYLVILTPLPH 105 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 24.6 bits (51), Expect = 9.0 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +3 Query: 345 WNRRRSHHRDPVHAFQLWYPYHIRILRTTVRQEPGIGLKRRHVGTLQEIVRVVVH 509 W+ PVH F + + YH I G LK+ H L ++ +VH Sbjct: 428 WDEFSREWNKPVHVFLMRHVYHSSI--------SGFKLKKSHAVLLTFLISALVH 474 >SPBC2D10.08c |||mitochondrial ribosomal protein subunit Yml6|Schizosaccharomyces pombe|chr 2|||Manual Length = 261 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 255 HRQLGKCHRRIDDSPAPLLR*GA 323 +RQ G H R+ D+ +P+ R GA Sbjct: 70 YRQKGTGHARVGDASSPIRRGGA 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,850,437 Number of Sequences: 5004 Number of extensions: 33414 Number of successful extensions: 116 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -