BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309G01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharo... 26 3.0 SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||... 25 6.8 >SPBC244.02c |||U3 snoRNP-associated protein Utp6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 488 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 329 FISAA*YIYLCWNYSL*SGCY-ESLINICN*H*HSFKSQNERVHSL 463 F+S ++ C++ + Y E++I ICN H FK+++ ++ + Sbjct: 296 FVSVLDALFECFDVPVVQYMYQENIIGICNEHFEHFKNESGEIYGV 341 >SPAC144.10c |gwt1|mug59|pig-W|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -3 Query: 264 IHWTDFLRYRC*KLKFAV*NSKIKRQNRMNKFVFITLLHYIIFIM 130 +HW F L +K+ + N FITLLH+ + ++ Sbjct: 223 MHWNFFFTLGFMALGVFFFRRSLKKVSYFNLATFITLLHHCLLVL 267 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,964,251 Number of Sequences: 5004 Number of extensions: 38182 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -