BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F12f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32470.1 68417.m04622 ubiquinol-cytochrome C reductase comple... 56 1e-08 At5g25450.1 68418.m03023 ubiquinol-cytochrome C reductase comple... 54 4e-08 At4g32470.2 68417.m04623 ubiquinol-cytochrome C reductase comple... 49 2e-06 At1g13420.1 68414.m01566 sulfotransferase family protein similar... 31 0.47 At5g28150.1 68418.m03402 expressed protein 30 0.82 At3g48830.1 68416.m05333 polynucleotide adenylyltransferase fami... 29 1.9 At4g17220.1 68417.m02590 expressed protein 29 2.5 At2g22720.3 68415.m02692 expressed protein 28 3.3 At2g22720.2 68415.m02691 expressed protein 28 3.3 At2g22720.1 68415.m02693 expressed protein 28 3.3 At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP1... 28 4.4 At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containi... 28 4.4 At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-proly... 27 5.8 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 27 5.8 At1g21600.1 68414.m02700 expressed protein similar to hypothetic... 27 5.8 At4g30020.1 68417.m04272 subtilase family protein contains simil... 27 7.7 At2g12900.1 68415.m01408 hypothetical protein similar to transcr... 27 7.7 >At4g32470.1 68417.m04622 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative similar to SP|P48502 Ubiquinol-cytochrome C reductase complex 14 kDa protein (EC 1.10.2.2) (CR14) {Solanum tuberosum}; contains Pfam profile PF02271: Ubiquinol-cytochrome C reductase complex 14kD subunit Length = 122 Score = 56.0 bits (129), Expect = 1e-08 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = +2 Query: 182 KYGLLRDDCLHE--TPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEE 355 +YGL DD + + D+ EA+ RLP VVD RN R+ RA+ LSM+ LPK+ Sbjct: 30 RYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTP 89 Query: 356 DSLYLTPIVEQVEKERLERE 415 YL ++ VE+E ERE Sbjct: 90 FRGYLQDMLALVERESKERE 109 >At5g25450.1 68418.m03023 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative similar to SP|P48502 Ubiquinol-cytochrome C reductase complex 14 kDa protein (EC 1.10.2.2) (CR14) {Solanum tuberosum}; contains Pfam profile PF02271: Ubiquinol-cytochrome C reductase complex 14kD subunit Length = 122 Score = 54.4 bits (125), Expect = 4e-08 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 3/81 (3%) Frame = +2 Query: 182 KYGLLRDDC---LHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYE 352 +YGL DD L++ D+ EAL RLP +VD RN R++RA+ LSM+ LP Sbjct: 30 RYGLRYDDLYDPLYDL-DIKEALNRLPREIVDARNQRLMRAMDLSMKHEYLPDNLQAVQT 88 Query: 353 EDSLYLTPIVEQVEKERLERE 415 YL ++ V++ER ERE Sbjct: 89 PFRSYLQDMLALVKRERAERE 109 >At4g32470.2 68417.m04623 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative similar to SP|P48502 Ubiquinol-cytochrome C reductase complex 14 kDa protein (EC 1.10.2.2) (CR14) {Solanum tuberosum}; contains Pfam profile PF02271: Ubiquinol-cytochrome C reductase complex 14kD subunit Length = 101 Score = 48.8 bits (111), Expect = 2e-06 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = +2 Query: 182 KYGLLRDDCLHE--TPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKE 334 +YGL DD + + D+ EA+ RLP VVD RN R+ RA+ LSM+ LPK+ Sbjct: 30 RYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKD 82 >At1g13420.1 68414.m01566 sulfotransferase family protein similar to steroid sulfotransferase 1 GI:3420004 from (Brassica napus); contains Pfam profile PF00685: Sulfotransferase domain Length = 331 Score = 31.1 bits (67), Expect = 0.47 Identities = 21/51 (41%), Positives = 29/51 (56%) Frame = +3 Query: 234 KHSADFHPMLLTRETSVLYVPYSSPCKKQSYLKKSGQNMKKIPYT*PQLLS 386 KH++D HP LLT L VPY + YLK S ++ K+P + P+L S Sbjct: 98 KHTSDNHP-LLTHNPHEL-VPY---LELDLYLKSSKPDLTKLPSSSPRLFS 143 >At5g28150.1 68418.m03402 expressed protein Length = 289 Score = 30.3 bits (65), Expect = 0.82 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -3 Query: 375 GVKYRESSSYFVHSSLGR-IVFCMESCMARTIRKFLSSTTWDGSLRSASVTSGV--SCKQ 205 GV+ +SSS + +V C+ C R R L + TW +L SVT GV SC Q Sbjct: 12 GVQVADSSSSSNSGKNAQNLVTCIYQCRIRG-RNCLITVTWTKNLMGQSVTVGVDDSCNQ 70 Query: 204 S 202 S Sbjct: 71 S 71 >At3g48830.1 68416.m05333 polynucleotide adenylyltransferase family protein / RNA recognition motif (RRM)-containing protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profiles PF01743: polyA polymerase family protein, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 881 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +2 Query: 281 RIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEK 427 RI ++ + QK +PK++ + ED L PI+++ KE E E E+ Sbjct: 466 RIFECVKENGQKGFVPKQDSKREPEDDLETKPILKK-HKENSEEENKEQ 513 >At4g17220.1 68417.m02590 expressed protein Length = 513 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = +2 Query: 197 RDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTP 376 ++D L EALRR+ +H D+ + + I + + K E + +ED L Sbjct: 82 KEDALAAQDAAEEALRRVYTHQQDDDSLPLESIIAPLESQIKIHKHEISALQEDKKALER 141 Query: 377 IVEQVEKERLEREQ 418 + + E LE E+ Sbjct: 142 LTKSKESALLEAER 155 >At2g22720.3 68415.m02692 expressed protein Length = 569 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = +2 Query: 308 MQKTILPKEEWTKYEEDSLYLTPIVEQVEKE-----RLEREQWEKE 430 M + +LP + +++Y++D + + E ++KE R+ RE+ E+E Sbjct: 503 MLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREEDERE 548 >At2g22720.2 68415.m02691 expressed protein Length = 672 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = +2 Query: 308 MQKTILPKEEWTKYEEDSLYLTPIVEQVEKE-----RLEREQWEKE 430 M + +LP + +++Y++D + + E ++KE R+ RE+ E+E Sbjct: 606 MLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREEDERE 651 >At2g22720.1 68415.m02693 expressed protein Length = 340 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = +2 Query: 308 MQKTILPKEEWTKYEEDSLYLTPIVEQVEKE-----RLEREQWEKE 430 M + +LP + +++Y++D + + E ++KE R+ RE+ E+E Sbjct: 274 MLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREEDERE 319 >At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 968 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +2 Query: 269 ERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKEY 433 ER RI + L +K E+W L I E++++ LE +Q E+EY Sbjct: 515 ERLNRIETELVLLKEKQAELTEQWEHERSVMSRLQSIKEEIDRVNLEIQQAEREY 569 >At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 895 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 155 WAYNLSGFNKYGLLRD 202 WA +SGFN+YG LR+ Sbjct: 519 WASMISGFNEYGYLRE 534 >At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein SP:Q9M222; similar to FKBP-type peptidyl-prolyl cis-trans isomerase fkpA precursor (PPiase) (Rotamase)(SP:Q8X880) [Escherichia coli O157:H7] ; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 242 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 279 SVLYVPYSSPCKKQSYLKKSGQNMKKIPYT*PQLLSKLRKRGWRESS 419 S++YV +SPC L S + K PY +LL + KR RE++ Sbjct: 47 SLVYVLVASPCLLLPALSSSAKTKSKSPYDERRLLEQ-NKRIQRENN 92 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 200 DDCLHETPDVTEALRR-LPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKY 349 DD +H E RR +PS ++ +IVRAI+ K P+EE Y Sbjct: 242 DDAIHPLSSAPEPKRRFIPSKWEAKKVVKIVRAIRKGWIKFDKPEEEPNVY 292 >At1g21600.1 68414.m02700 expressed protein similar to hypothetical protein GB:AAD41412 GI:5263310 from [Arabidopsis thaliana] Length = 328 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 275 NFRIVRAIQLSMQKTILPKEEWTKYEED 358 +F+I+ + T++ +EEWTK ED Sbjct: 284 SFKIIHVGERDDPTTVIEREEWTKTRED 311 >At4g30020.1 68417.m04272 subtilase family protein contains similarity to meiotic serine proteinase TMP GI:6468325 from [Lycopersicon esculentum] Length = 816 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +2 Query: 191 LLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEW 340 L+ H +PD E LRR P +R++++ + + Q LP + W Sbjct: 92 LINGFAAHVSPDQAEMLRRAPGVKSVDRDWKVRKLTTHTPQFLGLPTDVW 141 >At2g12900.1 68415.m01408 hypothetical protein similar to transcription factor(bZIP family) VSF-1 GI:3425907 from [Lycopersicon esculentum] Length = 264 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 281 GSFSRQQHGMEVCGVLQLHQEFHASN 204 GS Q+ ME C VLQ +EF SN Sbjct: 217 GSVELQRLKMETCEVLQYRREFDRSN 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,439,715 Number of Sequences: 28952 Number of extensions: 199829 Number of successful extensions: 611 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -