BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F11f (495 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) si... 113 5e-26 At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) si... 113 5e-26 At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) id... 112 1e-25 At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ri... 111 2e-25 At4g11860.1 68417.m01887 expressed protein contains Pfam domain ... 29 1.3 At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase famil... 28 3.0 At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase famil... 28 3.0 At5g53660.1 68418.m06665 expressed protein 27 5.3 At4g21130.1 68417.m03055 transducin family protein / WD-40 repea... 27 5.3 At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family prot... 27 5.3 At5g51195.1 68418.m06348 hypothetical protein 27 6.9 At5g45160.1 68418.m05544 root hair defective 3 GTP-binding (RHD3... 27 9.2 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 27 9.2 >At1g74270.1 68414.m08601 60S ribosomal protein L35a (RPL35aC) similar to ribosomal protein L33B GB:NP_014877 from [Saccharomyces cerevisiae] Length = 112 Score = 113 bits (273), Expect = 5e-26 Identities = 53/110 (48%), Positives = 70/110 (63%) Frame = +3 Query: 126 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 305 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Y+Y+AK + Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRMAYIYKAKTKK------ 64 Query: 306 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPSRI 455 + R IWGKVTRPHGNSG VRAKF SNLP ++MG R+RV +YPS I Sbjct: 65 --NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112 >At1g07070.1 68414.m00753 60S ribosomal protein L35a (RPL35aA) similar to ribosomal protein L35a GI:57118 from [Rattus norvegicus] Length = 112 Score = 113 bits (273), Expect = 5e-26 Identities = 54/110 (49%), Positives = 69/110 (62%) Frame = +3 Query: 126 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 305 RLY + GYKR NQ+ NT+L++VEG + +Y GK Y+Y+AK + Sbjct: 11 RLYVRGTILGYKRSKSNQYPNTSLVQVEGVNTTEEVSWYKGKRMAYIYKAKTKK------ 64 Query: 306 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPSRI 455 + R IWGKVTRPHGNSG VRAKF SNLP ++MG R+RV +YPS I Sbjct: 65 --NGSHYRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI 112 >At1g41880.1 68414.m04836 60S ribosomal protein L35a (RPL35aB) identical to GB:CAB81600 from [Arabidopsis thaliana] Length = 111 Score = 112 bits (269), Expect = 1e-25 Identities = 52/110 (47%), Positives = 70/110 (63%) Frame = +3 Query: 126 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 305 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Y+Y+AK + Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLIQIEGVNTQEEVNWYKGKRLAYIYKAKTKK------ 63 Query: 306 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPSRI 455 + R IWGKVTRPHGNSG VR+KF SNLP ++MG R+RV +YPS I Sbjct: 64 --NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111 >At3g55750.1 68416.m06194 60S ribosomal protein L35a (RPL35aD) ribosomal protein L35a.e.c15, Saccharomyces cerevisiae, PIR:S44069 Length = 111 Score = 111 bits (268), Expect = 2e-25 Identities = 52/110 (47%), Positives = 70/110 (63%) Frame = +3 Query: 126 RLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGP 305 RLY + GYKR NQ+ NT+L+++EG + + +Y GK Y+Y+AK + Sbjct: 10 RLYVRGTVLGYKRSKSNQYPNTSLVQIEGVNTQEEVNWYKGKRLAYIYKAKTKK------ 63 Query: 306 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPSRI 455 + R IWGKVTRPHGNSG VR+KF SNLP ++MG R+RV +YPS I Sbjct: 64 --NGSHYRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI 111 >At4g11860.1 68417.m01887 expressed protein contains Pfam domain PF04424: Protein of unknown function (DUF544) Length = 682 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = +3 Query: 207 EGAKDRNDAVFYAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAK 386 EG K+R VF+ H +++ + + +G + +W K+ +G++ + A Sbjct: 508 EGLKERELCVFFRNNHFCTMFKYEGELYLLATDQGYLNQPDLVWEKLNEVNGDTAFMTAT 567 Query: 387 FK 392 FK Sbjct: 568 FK 569 >At2g04350.2 68415.m00434 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -3 Query: 481 FL*LAEGS*ILEGYSITRILCPIAWAGRLDLNLARTLPELPCGRVTL 341 F+ + GS I +GY +T ++ D + R P LPCG V L Sbjct: 463 FINICMGSPIGQGYGLTETCAGATFSEWDDPAVGRVGPPLPCGYVKL 509 >At2g04350.1 68415.m00433 long-chain-fatty-acid--CoA ligase family protein / long-chain acyl-CoA synthetase family protein (LACS8) similar to LACS 4 [SP|O35547] from Rattus norvegicus, LACS 4 [SP|O60488] from Homo sapiens; contains Pfam HMM hit: AMP-binding enzymes PF00501 Length = 720 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -3 Query: 481 FL*LAEGS*ILEGYSITRILCPIAWAGRLDLNLARTLPELPCGRVTL 341 F+ + GS I +GY +T ++ D + R P LPCG V L Sbjct: 463 FINICMGSPIGQGYGLTETCAGATFSEWDDPAVGRVGPPLPCGYVKL 509 >At5g53660.1 68418.m06665 expressed protein Length = 365 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 306 RGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIR-VMLYPSRI*EPSANYKN 482 RG+ + + +RP+ N GSV+ + LP + I+ L P + +NY++ Sbjct: 140 RGRPRSRKHVEPPYSRPNNNGGSVKNRDLKKLPQKLSSSSIKDKTLEPMEVSSSISNYRD 199 Query: 483 KNKS 494 S Sbjct: 200 SRGS 203 >At4g21130.1 68417.m03055 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); some similarity to a group of proteins with homology to mammalian apoptosis regulators identified in zebrafish (PUBMED:10917738)Apaf-1(gi:7677507) Length = 537 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -2 Query: 437 HHSYSVS-HSLGREVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWCPLLSS 270 H S +S +LGRE L +G D G + P+ST+L + A+ ++ C ++S Sbjct: 304 HQSELLSIDALGRERVLSVGRDRTMQLYKVGIVVPESTRLIYRASESNFECCCFVNS 360 >At3g05180.1 68416.m00565 GDSL-motif lipase/hydrolase family protein similar to early nodulin ENOD8 [Medicago sativa] GI:304037, elicitor-induced glycoprotein iEP4 [Daucus carota] GI:1911765, lanatoside 15'-O-acetylesterase [Digitalis lanata] GI:3688284; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 379 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 380 SDTARVAMWAGHLAPDSTQLGFFATGTSGNWC 285 SDT ++ G L S ++ FF + TSG +C Sbjct: 45 SDTGELSSGLGFLPQPSYEITFFRSPTSGRFC 76 >At5g51195.1 68418.m06348 hypothetical protein Length = 267 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 Query: 401 EVRLELGSDTARVAMWAGHLAPDSTQLGFFATGTSGNWC 285 E++ E+ S+ W D T FFA+ SG WC Sbjct: 209 EIQAEMESEDVAATFWID----DETHDDFFASSKSGWWC 243 >At5g45160.1 68418.m05544 root hair defective 3 GTP-binding (RHD3) family protein contains Pfam profile: PF05879 root hair defective 3 GTP-binding protein (RHD3) family Length = 834 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +3 Query: 258 VYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKF 389 ++V R K +TPI R + ++ IW V +P + + +F Sbjct: 167 LFVIRDKTKTPIELLERALREDIQKIWDSVRKPEAHKNTPLNEF 210 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 26.6 bits (56), Expect = 9.2 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +3 Query: 279 KRTPIPGGPRGKKTKLRAIWGKVTRPHGNSGSVRAKFKSNLPAQAMGHRIRV 434 K P P P K +G GN+ ++ K KSN M + RV Sbjct: 132 KPAPSPPKPENKTIPAVFFFGDSVFDTGNNNNLETKIKSNYRPYGMDFKFRV 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,695,742 Number of Sequences: 28952 Number of extensions: 231561 Number of successful extensions: 643 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -