BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F09f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 5.8 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 5.8 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = +1 Query: 226 SSGPVVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRN 366 S+ V + G +V +G+Q G +QP T++ + + +N Sbjct: 909 SNSQVQGVAVPGSGIVASGQQHAGGWQSIYAQPQTVQDQIVSEYYQN 955 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 5.8 Identities = 6/19 (31%), Positives = 14/19 (73%) Frame = -1 Query: 428 SVNQRPISFLADSTLSEPW 372 S+N+ ++++AD L++ W Sbjct: 43 SINEESMTYVADIFLAQSW 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,818 Number of Sequences: 438 Number of extensions: 2946 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -