BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 188 3e-48 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 41 5e-04 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 41 5e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 41 5e-04 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 41 5e-04 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 41 5e-04 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 41 5e-04 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 41 5e-04 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 41 5e-04 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 41 5e-04 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 41 5e-04 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 41 5e-04 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 41 5e-04 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 41 5e-04 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 41 5e-04 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 40 0.002 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.004 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 38 0.004 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 38 0.004 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 38 0.004 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 38 0.004 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 38 0.004 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 38 0.004 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 38 0.004 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 38 0.004 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.004 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.004 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 38 0.004 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 38 0.004 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 38 0.004 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 38 0.004 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 38 0.004 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 38 0.004 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 38 0.004 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 38 0.004 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 38 0.004 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 38 0.004 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 38 0.004 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 38 0.004 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 38 0.004 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 38 0.004 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 38 0.004 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 38 0.004 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 38 0.004 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 38 0.004 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 38 0.004 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 38 0.004 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 38 0.004 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 38 0.004 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 38 0.004 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 38 0.004 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 38 0.004 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 38 0.004 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 38 0.004 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 38 0.004 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 38 0.004 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 38 0.004 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 38 0.004 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 38 0.004 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 38 0.004 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 38 0.004 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 38 0.004 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 38 0.004 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 38 0.004 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 38 0.004 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 38 0.004 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_24066| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 38 0.004 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 38 0.004 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 38 0.004 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 38 0.004 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 38 0.004 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 38 0.004 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 38 0.004 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 38 0.004 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 38 0.004 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 38 0.004 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 38 0.004 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20543| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 38 0.004 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 38 0.004 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 38 0.004 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 38 0.004 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 38 0.004 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 188 bits (457), Expect = 3e-48 Identities = 85/98 (86%), Positives = 92/98 (93%) Frame = +3 Query: 24 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 203 MT+KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY Sbjct: 1 MTKKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYE 60 Query: 204 MFQLPKLYAKLHYCVSCAIHSKVVRNRSKKDRRIRTPP 317 ++ LPKLY KLHYCVSCAIHSKVVRNRSK+DR+IRTPP Sbjct: 61 VYALPKLYVKLHYCVSCAIHSKVVRNRSKEDRKIRTPP 98 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 252 VTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 920 VTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 32 VTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 407 VTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 256 VTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 323 VTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 389 VTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 81 VTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 63 VTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 299 VTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 283 VTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 272 VTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 297 VTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 481 VTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 150 VTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 316 VTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 166 VTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 359 VTPGFSQSRRCKTTASEL 376 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 40 VTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 26 VTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 225 VTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 617 VTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 253 VTPGFSQSRRCKTTASEL 270 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 93 VTPGFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 531 VTPGFSQSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 33 VTPGFSQSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 114 VTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 422 VTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 26 VTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 41.1 bits (92), Expect = 5e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASEL 468 VTPGFSQSRRCKTTASEL Sbjct: 215 VTPGFSQSRRCKTTASEL 232 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 40.7 bits (91), Expect = 7e-04 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 517 RQXFPSHDVVKRRPANCN 464 RQ FPSHDVVKRRP NCN Sbjct: 77 RQGFPSHDVVKRRPVNCN 94 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 4 ITIHWPSFYNVVTGKTLAL 22 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASE 471 VTPGFSQSRRCKTTASE Sbjct: 40 VTPGFSQSRRCKTTASE 56 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 82 YNSLAVVLQRRDWENPGV 99 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 4 ITIHWPSFYNVVTGKTLAL 22 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 521 VTPGFSQSRRCKTTASE 471 VTPGFSQSRRCKTTASE Sbjct: 562 VTPGFSQSRRCKTTASE 578 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 4 ITIHWPSFYNVVTGKTLAL 22 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 4 ITIHWPSFYNVVTGKTLAL 22 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 82 ITIHWPSFYNVVTGKTLAL 100 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 518 TPGFSQSRRCKTTASEL 468 TPGFSQSRRCKTTASEL Sbjct: 63 TPGFSQSRRCKTTASEL 79 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 4 ITIHWPSFYNVVTGKTLAL 22 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +2 Query: 464 ITVRWPSFYNVVTGKXLAL 520 IT+ WPSFYNVVTGK LAL Sbjct: 4 ITIHWPSFYNVVTGKTLAL 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -2 Query: 517 RQXFPSHDVVKRRPANCN 464 R FPSHDVVKRRP NCN Sbjct: 55 RSGFPSHDVVKRRPVNCN 72 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +1 Query: 463 NYSSLAVVLQRRDWEXPGV 519 +Y+SLAVVLQRRDWE PGV Sbjct: 61 DYNSLAVVLQRRDWENPGV 79 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 32 YNSLAVVLQRRDWENPGV 49 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 41 YNSLAVVLQRRDWENPGV 58 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 59 YNSLAVVLQRRDWENPGV 76 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 64 YNSLAVVLQRRDWENPGV 81 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 35 YNSLAVVLQRRDWENPGV 52 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 55 YNSLAVVLQRRDWENPGV 72 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 67 YNSLAVVLQRRDWENPGV 84 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 43 YNSLAVVLQRRDWENPGV 60 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 32 YNSLAVVLQRRDWENPGV 49 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 47 YNSLAVVLQRRDWENPGV 64 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 56 YNSLAVVLQRRDWENPGV 73 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 50 YNSLAVVLQRRDWENPGV 67 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 66 YNSLAVVLQRRDWENPGV 83 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 54 YNSLAVVLQRRDWENPGV 71 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 37 YNSLAVVLQRRDWENPGV 54 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 213 YNSLAVVLQRRDWENPGV 230 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 108 YNSLAVVLQRRDWENPGV 125 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 44 YNSLAVVLQRRDWENPGV 61 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 378 YNSLAVVLQRRDWENPGV 395 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 104 YNSLAVVLQRRDWENPGV 121 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 80 YNSLAVVLQRRDWENPGV 97 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 36 YNSLAVVLQRRDWENPGV 53 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 5 YNSLAVVLQRRDWENPGV 22 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 35 YNSLAVVLQRRDWENPGV 52 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 100 YNSLAVVLQRRDWENPGV 117 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 42 YNSLAVVLQRRDWENPGV 59 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 337 YNSLAVVLQRRDWENPGV 354 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 77 YNSLAVVLQRRDWENPGV 94 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 47 YNSLAVVLQRRDWENPGV 64 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 56 YNSLAVVLQRRDWENPGV 73 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 131 YNSLAVVLQRRDWENPGV 148 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 60 YNSLAVVLQRRDWENPGV 77 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 36 YNSLAVVLQRRDWENPGV 53 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 140 YNSLAVVLQRRDWENPGV 157 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 57 YNSLAVVLQRRDWENPGV 74 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 31 YNSLAVVLQRRDWENPGV 48 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 70 YNSLAVVLQRRDWENPGV 87 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 64 YNSLAVVLQRRDWENPGV 81 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 53 YNSLAVVLQRRDWENPGV 70 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 66 YNSLAVVLQRRDWENPGV 83 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 253 YNSLAVVLQRRDWENPGV 270 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 47 YNSLAVVLQRRDWENPGV 64 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 34 YNSLAVVLQRRDWENPGV 51 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 98 YNSLAVVLQRRDWENPGV 115 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 111 YNSLAVVLQRRDWENPGV 128 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 55 YNSLAVVLQRRDWENPGV 72 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 31 YNSLAVVLQRRDWENPGV 48 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 393 YNSLAVVLQRRDWENPGV 410 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 42 YNSLAVVLQRRDWENPGV 59 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 51 YNSLAVVLQRRDWENPGV 68 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 116 YNSLAVVLQRRDWENPGV 133 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 52 YNSLAVVLQRRDWENPGV 69 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 62 YNSLAVVLQRRDWENPGV 79 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 65 YNSLAVVLQRRDWENPGV 82 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 411 YNSLAVVLQRRDWENPGV 428 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 108 YNSLAVVLQRRDWENPGV 125 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 64 YNSLAVVLQRRDWENPGV 81 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 53 YNSLAVVLQRRDWENPGV 70 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 43 YNSLAVVLQRRDWENPGV 60 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 46 YNSLAVVLQRRDWENPGV 63 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 158 YNSLAVVLQRRDWENPGV 175 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 62 YNSLAVVLQRRDWENPGV 79 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 49 YNSLAVVLQRRDWENPGV 66 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 60 YNSLAVVLQRRDWENPGV 77 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 39 YNSLAVVLQRRDWENPGV 56 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 182 YNSLAVVLQRRDWENPGV 199 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 31 YNSLAVVLQRRDWENPGV 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 37 YNSLAVVLQRRDWENPGV 54 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 51 YNSLAVVLQRRDWENPGV 68 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 48 YNSLAVVLQRRDWENPGV 65 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 31 YNSLAVVLQRRDWENPGV 48 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 32 YNSLAVVLQRRDWENPGV 49 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 46 YNSLAVVLQRRDWENPGV 63 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 36 YNSLAVVLQRRDWENPGV 53 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 38 YNSLAVVLQRRDWENPGV 55 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 81 YNSLAVVLQRRDWENPGV 98 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 337 YNSLAVVLQRRDWENPGV 354 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 106 YNSLAVVLQRRDWENPGV 123 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 83 YNSLAVVLQRRDWENPGV 100 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 291 YNSLAVVLQRRDWENPGV 308 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 54 YNSLAVVLQRRDWENPGV 71 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 55 YNSLAVVLQRRDWENPGV 72 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 408 YNSLAVVLQRRDWENPGV 425 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 92 YNSLAVVLQRRDWENPGV 109 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 48 YNSLAVVLQRRDWENPGV 65 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 90 YNSLAVVLQRRDWENPGV 107 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 208 YNSLAVVLQRRDWENPGV 225 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 35 YNSLAVVLQRRDWENPGV 52 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 144 YNSLAVVLQRRDWENPGV 161 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 42 YNSLAVVLQRRDWENPGV 59 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 32 YNSLAVVLQRRDWENPGV 49 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 52 YNSLAVVLQRRDWENPGV 69 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 192 YNSLAVVLQRRDWENPGV 209 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 50 YNSLAVVLQRRDWENPGV 67 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 29 YNSLAVVLQRRDWENPGV 46 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 83 YNSLAVVLQRRDWENPGV 100 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 46 YNSLAVVLQRRDWENPGV 63 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 184 YNSLAVVLQRRDWENPGV 201 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 54 YNSLAVVLQRRDWENPGV 71 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 64 YNSLAVVLQRRDWENPGV 81 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 47 YNSLAVVLQRRDWENPGV 64 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 73 YNSLAVVLQRRDWENPGV 90 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 93 YNSLAVVLQRRDWENPGV 110 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 37 YNSLAVVLQRRDWENPGV 54 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 46 YNSLAVVLQRRDWENPGV 63 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 660 YNSLAVVLQRRDWENPGV 677 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 45 YNSLAVVLQRRDWENPGV 62 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 34 YNSLAVVLQRRDWENPGV 51 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 35 YNSLAVVLQRRDWENPGV 52 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 39 YNSLAVVLQRRDWENPGV 56 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 53 YNSLAVVLQRRDWENPGV 70 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 47 YNSLAVVLQRRDWENPGV 64 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 123 YNSLAVVLQRRDWENPGV 140 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 165 YNSLAVVLQRRDWENPGV 182 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 77 YNSLAVVLQRRDWENPGV 94 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 27 YNSLAVVLQRRDWENPGV 44 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 42 YNSLAVVLQRRDWENPGV 59 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 72 YNSLAVVLQRRDWENPGV 89 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 922 YNSLAVVLQRRDWENPGV 939 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 43 YNSLAVVLQRRDWENPGV 60 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 33 YNSLAVVLQRRDWENPGV 50 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 350 YNSLAVVLQRRDWENPGV 367 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 80 YNSLAVVLQRRDWENPGV 97 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 62 YNSLAVVLQRRDWENPGV 79 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 72 YNSLAVVLQRRDWENPGV 89 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 5 YNSLAVVLQRRDWENPGV 22 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 123 YNSLAVVLQRRDWENPGV 140 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 1470 YNSLAVVLQRRDWENPGV 1487 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 94 YNSLAVVLQRRDWENPGV 111 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 54 YNSLAVVLQRRDWENPGV 71 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 51 YNSLAVVLQRRDWENPGV 68 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 101 YNSLAVVLQRRDWENPGV 118 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 44 YNSLAVVLQRRDWENPGV 61 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 905 YNSLAVVLQRRDWENPGV 922 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 36 YNSLAVVLQRRDWENPGV 53 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 40 YNSLAVVLQRRDWENPGV 57 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 38 YNSLAVVLQRRDWENPGV 55 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 78 YNSLAVVLQRRDWENPGV 95 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 86 YNSLAVVLQRRDWENPGV 103 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 460 YNSLAVVLQRRDWENPGV 477 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 53 YNSLAVVLQRRDWENPGV 70 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 47 YNSLAVVLQRRDWENPGV 64 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 26 YNSLAVVLQRRDWENPGV 43 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 49 YNSLAVVLQRRDWENPGV 66 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 93 YNSLAVVLQRRDWENPGV 110 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 466 YSSLAVVLQRRDWEXPGV 519 Y+SLAVVLQRRDWE PGV Sbjct: 72 YNSLAVVLQRRDWENPGV 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,771,828 Number of Sequences: 59808 Number of extensions: 264416 Number of successful extensions: 3585 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3584 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -