BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F07f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK126276-1|BAC86512.1| 457|Homo sapiens protein ( Homo sapiens ... 33 0.80 AL136131-5|CAI19963.2| 264|Homo sapiens mitochondrial ribosomal... 30 5.7 BC010364-1|AAH10364.1| 196|Homo sapiens mitochondrial ribosomal... 29 9.9 AL136131-6|CAC19510.1| 196|Homo sapiens mitochondrial ribosomal... 29 9.9 AK001410-1|BAA91675.1| 196|Homo sapiens protein ( Homo sapiens ... 29 9.9 AB049952-1|BAB41005.1| 196|Homo sapiens mitochondrial ribosomal... 29 9.9 >AK126276-1|BAC86512.1| 457|Homo sapiens protein ( Homo sapiens cDNA FLJ44290 fis, clone TRACH2019473. ). Length = 457 Score = 32.7 bits (71), Expect = 0.80 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 5/99 (5%) Frame = +1 Query: 52 QILLDYHYNTAHQFFFIALVGRRAYGQFDCE*LPSPMDFSNAKVRVKLLPTVKYSPQAMF 231 ++LLD Y T + G RA G DCE L + + K++ T +F Sbjct: 212 KMLLDLGYTTFADTVLLDFTGIRAKGPIDCESLKTDLSIQTRNAEEKIMNTWYPKVINLF 271 Query: 232 EEVS*RSG---NTVDG--SSFQSRMVRDKKDLWKRTVDG 333 + G +D S + M KDL +RTV+G Sbjct: 272 TKKEALEGVKPEKLDAFYSCVSTLMSNQLKDLLRRTVEG 310 >AL136131-5|CAI19963.2| 264|Homo sapiens mitochondrial ribosomal protein S18A protein. Length = 264 Score = 29.9 bits (64), Expect = 5.7 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 Query: 134 LIVSDYRRPWTSAMPRSESNCCLP*STLHKPCLKKCHSARETPW 265 L++S + RP +PR + C + C+K H A PW Sbjct: 87 LLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGRRPW 130 >BC010364-1|AAH10364.1| 196|Homo sapiens mitochondrial ribosomal protein S18A protein. Length = 196 Score = 29.1 bits (62), Expect = 9.9 Identities = 22/83 (26%), Positives = 32/83 (38%) Frame = +2 Query: 134 LIVSDYRRPWTSAMPRSESNCCLP*STLHKPCLKKCHSARETPWTGAHFKVGWYVTKKIS 313 L++S + RP +PR + C + C+K H A P G K Sbjct: 87 LLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQ 146 Query: 314 GNAL*MVAVAPGSMDELYSGGGR 382 N + APGS+ +Y G R Sbjct: 147 LNRY-LTRWAPGSVKPIYKKGPR 168 >AL136131-6|CAC19510.1| 196|Homo sapiens mitochondrial ribosomal protein S18A protein. Length = 196 Score = 29.1 bits (62), Expect = 9.9 Identities = 22/83 (26%), Positives = 32/83 (38%) Frame = +2 Query: 134 LIVSDYRRPWTSAMPRSESNCCLP*STLHKPCLKKCHSARETPWTGAHFKVGWYVTKKIS 313 L++S + RP +PR + C + C+K H A P G K Sbjct: 87 LLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQ 146 Query: 314 GNAL*MVAVAPGSMDELYSGGGR 382 N + APGS+ +Y G R Sbjct: 147 LNRY-LTRWAPGSVKPIYKKGPR 168 >AK001410-1|BAA91675.1| 196|Homo sapiens protein ( Homo sapiens cDNA FLJ10548 fis, clone NT2RP2001969. ). Length = 196 Score = 29.1 bits (62), Expect = 9.9 Identities = 22/83 (26%), Positives = 32/83 (38%) Frame = +2 Query: 134 LIVSDYRRPWTSAMPRSESNCCLP*STLHKPCLKKCHSARETPWTGAHFKVGWYVTKKIS 313 L++S + RP +PR + C + C+K H A P G K Sbjct: 87 LLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQ 146 Query: 314 GNAL*MVAVAPGSMDELYSGGGR 382 N + APGS+ +Y G R Sbjct: 147 LNRY-LTRWAPGSVKPIYKKGPR 168 >AB049952-1|BAB41005.1| 196|Homo sapiens mitochondrial ribosomal protein S18a protein. Length = 196 Score = 29.1 bits (62), Expect = 9.9 Identities = 22/83 (26%), Positives = 32/83 (38%) Frame = +2 Query: 134 LIVSDYRRPWTSAMPRSESNCCLP*STLHKPCLKKCHSARETPWTGAHFKVGWYVTKKIS 313 L++S + RP +PR + C + C+K H A P G K Sbjct: 87 LLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQ 146 Query: 314 GNAL*MVAVAPGSMDELYSGGGR 382 N + APGS+ +Y G R Sbjct: 147 LNRY-LTRWAPGSVKPIYKKGPR 168 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,004,107 Number of Sequences: 237096 Number of extensions: 1510503 Number of successful extensions: 3355 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3355 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -