BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F03f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0457 + 17916177-17916526,17917397-17917523,17917887-179182... 30 1.3 07_03_1035 - 23426318-23426562,23426674-23426757,23426880-23427045 27 9.1 >11_04_0457 + 17916177-17916526,17917397-17917523,17917887-17918287, 17918496-17918704,17919328-17919449,17920437-17920562, 17920675-17920801,17920945-17921000 Length = 505 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = +3 Query: 51 EIMGDIVELNSTEGQVLYRANSSAIRIRVSFPLSAEPHITFYSKFPPHQELYQLYIGDV 227 +I+ + +N Q ++ SAI FPL H Y K P + Y++++GD+ Sbjct: 294 DIVSSVHYVNERYPQAGTSSSGSAIPPLTMFPLELASHKILYEKIPTGE--YKIFLGDI 350 >07_03_1035 - 23426318-23426562,23426674-23426757,23426880-23427045 Length = 164 Score = 27.1 bits (57), Expect = 9.1 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 153 AEPHITFYSKFPPHQELYQLYIGDVFKLVDILEGNVVDYYNKDPPTSFIEFKDFW 317 AEPH +K H E +Q + DV D + G DP T+F E +++ Sbjct: 22 AEPHPPSRNKDFLHNEEFQRVMRDVVVGPDYVPGGYALRILTDPATAFEELLEYY 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,188,732 Number of Sequences: 37544 Number of extensions: 283638 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -