BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 25 1.2 AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 23 6.2 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 6.2 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 8.2 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 114 SWLCKEPGLQWNSILQYLP*FPV 46 SW KEP WN I YLP P+ Sbjct: 174 SW--KEPPFTWNEIGSYLPTSPL 194 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 285 VGLCCNNQQHYPLICLQ 235 +G CC N + L+CLQ Sbjct: 123 LGECCENFSNRHLVCLQ 139 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.0 bits (47), Expect = 6.2 Identities = 6/20 (30%), Positives = 12/20 (60%) Frame = +2 Query: 296 YRVQRFLDIMAQWKISIWSV 355 Y+ F I+ W++ +W+V Sbjct: 75 YQTMDFFSILPLWRLIVWNV 94 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 146 WKANSNSYGTRVGSVKNLAFSGIQFYNISH 57 ++A+ S+G V + K S IQ NI H Sbjct: 68 YEASDTSFGNAVSNTKRELSSVIQNDNIDH 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,644 Number of Sequences: 2352 Number of extensions: 11575 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -