BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309F02f (344 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12670.1 68417.m01991 expressed protein ; expression support... 27 2.5 At1g51805.1 68414.m05838 leucine-rich repeat protein kinase, put... 27 3.4 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 26 5.9 At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, put... 26 7.7 >At4g12670.1 68417.m01991 expressed protein ; expression supported by MPSS Length = 520 Score = 27.5 bits (58), Expect = 2.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 186 KASTNLIKTGXEFKEIRISCSKHQKNNKTGIKLDNNVLSNSGR 314 KA + G + KE R K+Q+N +++VL+N GR Sbjct: 156 KAQPHSFAVGIKTKEKRRYSEKNQQNKTVATTHEHDVLTNDGR 198 >At1g51805.1 68414.m05838 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 253 CFEQLIRISLNSXPVLIKFVEALTHIGTKQINT 155 C QL++ S ++ P L+ +EA T I Q+ T Sbjct: 323 CILQLVKTSKSTLPPLLNAIEAFTVIDFLQVET 355 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 26.2 bits (55), Expect = 5.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 253 CFEQLIRISLNSXPVLIKFVEALTHIGTKQINTS 152 C+ QL++ ++ P LI +EA + I Q+ TS Sbjct: 325 CYLQLVKTPNSTLPPLINAIEAYSVIEFSQLETS 358 >At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 865 Score = 25.8 bits (54), Expect = 7.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 253 CFEQLIRISLNSXPVLIKFVEALTHIGTKQINTSG 149 C Q+++ ++ P L+ +EA T I Q+ T+G Sbjct: 302 CLLQVVKTLKSTLPPLLNAIEAFTVIDFPQMETNG 336 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,416,322 Number of Sequences: 28952 Number of extensions: 108263 Number of successful extensions: 238 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 238 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 419412672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -