BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E11f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 26 0.23 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 2.9 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 8.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 25.8 bits (54), Expect = 0.23 Identities = 9/37 (24%), Positives = 21/37 (56%) Frame = -3 Query: 459 FITRCYSFTVEVNREHLLSTYFIRKIGTRLRFEHRCI 349 F+T+ F V++ + L+ Y +K G+++ +C+ Sbjct: 749 FMTKLLEFDVKLQSDRLMIDYKTQKTGSKIHLFVKCV 785 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 8 GSRLSGRPSCMTTGRW 55 G R + RP +TT RW Sbjct: 40 GRRRAARPGVVTTPRW 55 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 Query: 61 LRPPTCRHAARSPT 20 L PTC A+ SPT Sbjct: 191 LPTPTCSEASSSPT 204 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 411 LLSTYFIRKIGTRLRFEHRCI 349 L+ Y I ++GT +R +C+ Sbjct: 125 LIFAYLIPEVGTWIRAVRKCL 145 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 411 LLSTYFIRKIGTRLRFEHRCI 349 L+ Y I ++GT +R +C+ Sbjct: 125 LIFAYLIPEVGTWIRAVRKCL 145 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,428 Number of Sequences: 336 Number of extensions: 2220 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -