BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E11f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 26 0.27 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 7.7 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 25.8 bits (54), Expect = 0.27 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 507 VLPPVITQIIILRVAFFITRCYSFTVEVNREHL 409 VLP I ++ + +A + R T VNR HL Sbjct: 231 VLPMTIIIVLYILIAIKLRRSRMLTATVNRNHL 263 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 Query: 269 GAQAGSAANTEVVVA*RIRRPMH 337 G GSA ++A R+ P+H Sbjct: 340 GTSQGSAGLPSAILAMRLSHPLH 362 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,665 Number of Sequences: 438 Number of extensions: 2892 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -