BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E07f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc... 26 3.9 SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 25 6.8 >SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 987 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 418 YDIFKTASSPITKHNYLNILLLWSCKEYFEILK 320 Y ++ + +TK N ++ LW K +FE LK Sbjct: 654 YSSWEKGDNFVTKKNVCTVMNLWVQKYFFEDLK 686 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 25.0 bits (52), Expect = 6.8 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = -2 Query: 451 TEHYQSIFLNFYDIFKTASSPITKHNYLNILLLWSCKEYFEILKKNLERIG 299 TEH+ S ++ K+ L + L+W+ K E +KK E G Sbjct: 418 TEHFNSTTTTEKELSSLHVGEERKNRSLPLSLIWNSKAREEYIKKQKEENG 468 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,730,543 Number of Sequences: 5004 Number of extensions: 30282 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -