BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E07f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45110.1 68416.m04869 hypothetical protein 27 5.8 At3g10790.1 68416.m01299 F-box family protein contains F-box dom... 27 5.8 >At3g45110.1 68416.m04869 hypothetical protein Length = 120 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 507 GLRCHNNYNCRDINNNV 457 G+ CHNNYNC I+N++ Sbjct: 13 GVVCHNNYNC-TIDNSI 28 >At3g10790.1 68416.m01299 F-box family protein contains F-box domain Pfam:PF00646 Length = 319 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 282 CQ*RRKP-IRSKFFFNISKYSLHDHNNNMFK*LCLVIGDD 398 CQ P +R+K + I + +DH + +K LC+ I D+ Sbjct: 150 CQFETLPRVRTKIYQEIFPFFGYDHVKDEYKVLCMTISDE 189 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,294,323 Number of Sequences: 28952 Number of extensions: 135214 Number of successful extensions: 225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -