BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 2.7 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 6.2 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 8.2 AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 23 8.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 121 FSPNGETLISCSEDDQIVIYDCEKGTQMI-TVNSKKYGVDL 240 +SP G+ + SED Q+V + T + +VN+++ +++ Sbjct: 1505 YSPTGKRVALLSEDGQVVDFAMHSKTAFVASVNARQCLIEM 1545 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 310 LSLHDNKYIRYFPGHTKKVVTMCLS 384 L+L N Y + P H K +++M +S Sbjct: 326 LTLQQNDYFKGSPAHRKPLLSMGIS 350 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 395 THFYLDH*TKHYDCGIFGRLIVRD 466 T FY H H G +G LIVR+ Sbjct: 180 TQFYHSHSGHHKVNGHYGALIVRE 203 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 288 FGGTVNCSVFGMCKMYQIDP 229 F TV+C V G+C Q +P Sbjct: 59 FISTVSCFVLGVCLRLQSNP 78 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,479 Number of Sequences: 2352 Number of extensions: 13423 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -