BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E02f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 3.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.6 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 6.6 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 306 KISNYSIQIHSEMCSINSVALYV 374 K+ NYS+Q+ + ++ LYV Sbjct: 320 KLENYSLQLINHRVVFTAMGLYV 342 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 192 TSFTIHVITKNGAEPKK 142 T+FTIH + GA+ +K Sbjct: 2044 TNFTIHYWIEKGADRRK 2060 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 274 RICIITFLLLHLISLVKFLSKLESFQNYVF 185 R+C + FLL +S + S L +F +F Sbjct: 273 RLCHLCFLLDEKLSYIILTSFLNNFYFIIF 302 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,228 Number of Sequences: 336 Number of extensions: 2030 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -