BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E02f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 6.8 SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|ch... 25 9.0 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.0 bits (52), Expect = 6.8 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 Query: 216 DKNLTRDIKCNSKNVIIH 269 D+ LTRD+K +++N ++H Sbjct: 106 DEMLTRDLKKSNENTVVH 123 >SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 301 ICYLSNYKLRICIITFLLLHLISLVKFLSKLESFQNYVFHYSC 173 +C L L C+ F+ +L ++ ESF+N +F ++C Sbjct: 68 LCVLEQKHLSECVAPFVW----TLSSSSNERESFENLIFEHAC 106 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,892,634 Number of Sequences: 5004 Number of extensions: 33803 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -