BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309E01f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46042| Best HMM Match : Extensin_2 (HMM E-Value=0.39) 31 0.76 SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 >SB_46042| Best HMM Match : Extensin_2 (HMM E-Value=0.39) Length = 418 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 67 PFNIV*TIICMYVCIYVCMYL*L*LCIYVYTYI 165 PF+++ + +YV +YV +Y+ + + +YVY Y+ Sbjct: 259 PFSMLRVYVYVYVYVYVYVYVYVYVYVYVYVYV 291 >SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +1 Query: 91 ICMYVCIYVCMYL*L*LCIYVYTY 162 + Y+ IY+ +Y+ + + IY+YTY Sbjct: 7 VTFYIYIYIYIYIYIYIYIYIYTY 30 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 85 TIICMYVCIYVCMYL*L*LCIYVYTYI 165 T + +YV +YV +Y+ + + +YVY YI Sbjct: 53 TYVYVYVYVYVYVYVYVYVYVYVYIYI 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,922,184 Number of Sequences: 59808 Number of extensions: 172323 Number of successful extensions: 341 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 331 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -