BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D12f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 84 8e-17 SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) 31 0.76 SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) 30 1.0 SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) 29 1.8 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) 29 2.3 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 29 2.3 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 28 4.1 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 28 4.1 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 5.4 SB_4930| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 7.1 SB_24238| Best HMM Match : RecR (HMM E-Value=3.7) 27 9.4 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 27 9.4 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 83.8 bits (198), Expect = 8e-17 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +3 Query: 351 MRGAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQK 500 MRGAFGKPQGTVARV IGQ I+S+R+ D KA IEALRRAKFKFPGRQK Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFPGRQK 50 >SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 30.7 bits (66), Expect = 0.76 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -1 Query: 509 YVDLLTSGELELGTAQSLDDLCLPPVTRAHGHDGLSNANT--CYSTLRLAKRTT 354 Y + ++G + T D+C+P + HGH +ANT CY + A +T Sbjct: 68 YAESCSAGHYVVRTGNPFTDICIP--CQCHGHSDQCDANTGICYVRIYTADLST 119 >SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) Length = 177 Score = 30.7 bits (66), Expect = 0.76 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 201 LEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLS 320 L I C Y KN +D +RM +HP H IRIN ++S Sbjct: 115 LSYAHIFCGSYS-KNAAEDI--VRMSVHPLHPIRINGVVS 151 >SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) Length = 1023 Score = 30.3 bits (65), Expect = 1.0 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = -3 Query: 402 QCEHVLQYPEACQTHHASQSGAYQLQRMITFY*CG*RGKGEVSCGYGTDPFRSSLRGTYC 223 +C V Q P AC + S GA + Y C K V CG G T C Sbjct: 535 KCPDVTQAPVACTNGYYSGDGATECTLCPAGYSCADATKSPVPCGKGYYSTNGQTSCTEC 594 Query: 222 SRYVLPPKPLSSA 184 S P L ++ Sbjct: 595 SAGFYCPVELGTS 607 >SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) Length = 718 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 13 GAGQQDATGTAKINRIRNRGSVGVYLIPRSVSSIWVRRERPLTTF 147 G G T N++ +G V LIP+ +I VR +P T+F Sbjct: 313 GNGTACYTVEGSFNQLAGKGYVEAALIPKGARNIRVREVKPCTSF 357 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 204 PKPLSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQ 88 PK SS V+ RT AR ++R++ Y ++YG W Q Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331 >SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) Length = 650 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 232 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 101 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 252 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 294 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 232 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 101 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 1020 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 1062 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/55 (21%), Positives = 26/55 (47%) Frame = +3 Query: 357 GAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQKIYVSKKW 521 G G+P G+V + +++++ +W + E++ A + FP S+ W Sbjct: 1109 GVDGRPSGSVEILGSRDSFVAIQNGRQWMLDIEESISIAFYVFPNNSLGNTSRNW 1163 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +3 Query: 36 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQLSSEALEAGR 215 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 216 IC 221 +C Sbjct: 500 MC 501 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 28.3 bits (60), Expect = 4.1 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 15/88 (17%) Frame = -3 Query: 291 GKGEVSCGYGTDPFRS-SLRGTYCSRYVLPPK----PLSSAVHIRRTPSARTVES----- 142 G + GY P+ + S R Y + LPP+ P SS + ++ P + E+ Sbjct: 359 GNYSATPGYERVPYANGSERNGYYNGTYLPPQGVITPRSSPLTVQEDPMNGSRENGLSNG 418 Query: 141 -----RQRSLSSYPNRRYGSWDQVHPDR 73 RQ SY +RRYG ++ +PD+ Sbjct: 419 HSDSRRQPMRLSYDSRRYGGYEAYYPDQ 446 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 359 CVWQASGYCSTCSHWTAHHV 418 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_4930| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 1127 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 214 RPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 101 R +S+ S+ SC+ S + SGK + LF KS+ R Sbjct: 983 RKSSRTSQRSCASSMSSSSAESGKLEQLNLFDGKSRKR 1020 >SB_24238| Best HMM Match : RecR (HMM E-Value=3.7) Length = 153 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 186 AVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQVHP 79 A+ TP+ R E+RQR+ ++ RR S D ++P Sbjct: 102 AIFTLATPNRRPTETRQRAANTPSARRPSSPDVINP 137 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -3 Query: 195 LSSAVHIRRTP--SARTVESRQRSLSSYPNRRYGSWDQVHPDRTSISDT 55 LS ++I P S SR +S P R + +HPD S SDT Sbjct: 140 LSDTLNISHQPIASLSVCSSRILCISPVPGARLIGLETIHPDADSKSDT 188 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,921,744 Number of Sequences: 59808 Number of extensions: 433229 Number of successful extensions: 1428 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -