BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 25 1.5 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 23 6.2 AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 prote... 23 6.2 AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 prote... 23 6.2 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 8.2 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 8.2 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 23 8.2 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 8.2 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 183 QLSSEALEAGRICCNKYLVKNCGKDQFHIRMRLH 284 +L+ E L G CN + K CGK HIR H Sbjct: 487 RLTFERLSGG---CNLHRCKLCGKVVTHIRNHYH 517 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 89 RYTPTEPRFRIRFIFAVPVASCWPAP 12 R TP+ PR VP +S W P Sbjct: 48 RSTPSSPRLAQASTCPVPCSSIWSRP 73 >AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -1 Query: 509 YVDLLTSGELELGT 468 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -1 Query: 509 YVDLLTSGELELGT 468 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 485 ELELGTAQSLDDLCLPPVTRAHGHD 411 ELE A + DL LP T HD Sbjct: 283 ELETSVAPKMVDLWLPKFTIEDSHD 307 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 132 TVDDFPLCVHLVSDEYEQL 188 T + P +HL+ +EY++L Sbjct: 84 TCETLPSEIHLIKEEYDEL 102 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 8.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -2 Query: 250 PQFFTRYLLQQIRPASKASELSCSYSSDTKCT 155 PQ F L QQ +P S + SC Y+S+ T Sbjct: 106 PQKFL--LSQQQQPQSALTSQSCKYASEGPST 135 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 262 N*SFPQFFTRYLLQQIRPASKASELSCSY 176 N +FP + R L I K S +SCSY Sbjct: 462 NGTFPAAWKRQRLVLIPKPGKPSGVSCSY 490 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 623,876 Number of Sequences: 2352 Number of extensions: 14026 Number of successful extensions: 27 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -