BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D06f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 25 0.41 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 1.6 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 1.6 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 6.6 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 8.7 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 25.0 bits (52), Expect = 0.41 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +1 Query: 4 KSDSTQW---KTLTAQEKCSQGLLTERQVLA 87 ++DS W K LTA ++CS LL VLA Sbjct: 342 RADSVTWNPHKLLTAPQQCSTLLLRHEGVLA 372 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 423 ANTLFVSQFNGGTRQLDHTEQSASSGPAQPVPE 521 AN+ NGG +H Q G A VP+ Sbjct: 6 ANSYMPDMRNGGVVSAEHPHQHQHYGAAVQVPQ 38 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 423 ANTLFVSQFNGGTRQLDHTEQSASSGPAQPVPE 521 AN+ NGG +H Q G A VP+ Sbjct: 6 ANSYMPDMRNGGVVSAEHPHQHQHYGAAVQVPQ 38 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 279 EEMIRKRNHIASDAAALRYCVI 214 E +I K+N A A LR C++ Sbjct: 47 ECVINKKNRTACKACRLRKCLL 68 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 116 NVYKFPRLLIWTHWISLRSY 175 N K P ++IW+ +S R Y Sbjct: 445 NGVKIPLVIIWSSNLSKRPY 464 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,295 Number of Sequences: 336 Number of extensions: 2779 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -