BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D06f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0001 - 11373469-11373862,11374072-11374264,11374414-113744... 32 0.24 12_02_1088 - 25954506-25954652,25954769-25954918,25955011-259551... 29 1.7 02_04_0081 + 19541691-19541798,19541865-19542062,19542133-195421... 29 2.3 11_08_0035 - 27838495-27838655,27838750-27838897,27838987-278391... 27 9.1 03_05_0323 + 23102151-23102584,23102722-23102867,23102985-23103184 27 9.1 >09_03_0001 - 11373469-11373862,11374072-11374264,11374414-11374482, 11374858-11374984,11375223-11375485,11375697-11375785, 11375832-11375909,11376070-11376141,11376234-11376372, 11378857-11379323,11380781-11381345,11382553-11382622 Length = 841 Score = 32.3 bits (70), Expect = 0.24 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 280 LEWRDTDGQEYKVDLENGELKSKRRCPFSASPTNQKNIRRYCPEKLL 420 + W+DT +EY V L + +S + F A P + + Y P LL Sbjct: 269 ISWQDTTAKEYVVYLHFADFQSSKLREFDAYPDANQVVYNYTPHYLL 315 >12_02_1088 - 25954506-25954652,25954769-25954918,25955011-25955116, 25955247-25955569,25955656-25955790,25956310-25956444, 25956445-25956525,25956619-25956807,25956935-25957127, 25957244-25957350,25957457-25957531,25957619-25957774, 25957968-25958051,25958152-25958265,25958345-25958440, 25958543-25958633,25958721-25958836,25958934-25959093, 25960390-25960634 Length = 900 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 441 IRREYLLQQLLWTVSA-YIFLVCW 373 + R+ L Q+LWT+ Y+FL CW Sbjct: 561 LSRDMYLLQVLWTIRVNYLFLCCW 584 >02_04_0081 + 19541691-19541798,19541865-19542062,19542133-19542191, 19542274-19542994,19543382-19543723 Length = 475 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/80 (26%), Positives = 36/80 (45%) Frame = +1 Query: 43 EKCSQGLLTERQVLAAVSYVIYGQECIQVSATANLDTLDITKILLNKRGSVLAVACIYHA 222 ++ ++ L R+ L + ++ G E + ++ L+ LL RGS+ H Sbjct: 216 DRLTRDLAEVRKDLQKMRELVAGNERQRQGLERHMSELENN--LLEIRGSLRVTYTGLHQ 273 Query: 223 VAKRCGVACDVVAFPNHFFL 282 +A CGV + A PN F L Sbjct: 274 LAGECGVKTTISANPNEFSL 293 >11_08_0035 - 27838495-27838655,27838750-27838897,27838987-27839192, 27839291-27839972,27840074-27840247,27840963-27841181, 27841281-27841400,27841540-27841680,27841762-27841801, 27841969-27842129,27842506-27842589,27842659-27842721, 27842808-27842885,27842980-27842984,27843228-27843313, 27843354-27843544,27844089-27844166,27844255-27844365, 27844757-27844927,27845026-27845198,27845748-27845928 Length = 1090 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 412 KLLQQILSSYLNSMGVHDNWTTQNSLR-LVDLLNPSQ 519 +L Q I SS + S G H W T N+LR L ++ P Q Sbjct: 139 QLKQVIHSSNIISPGQHPEWNTINALRVLQSVVRPFQ 175 >03_05_0323 + 23102151-23102584,23102722-23102867,23102985-23103184 Length = 259 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 154 LDITKILLNKRGSVLAVACIYHAVAKRCGVACDVVAFPNHFFL 282 L++ +++ RGS+ H +A CGV + A P+ F L Sbjct: 20 LELEGHMIDIRGSLRTSFTSLHQLAGECGVTTTIPAHPDEFSL 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,032,419 Number of Sequences: 37544 Number of extensions: 308322 Number of successful extensions: 965 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -