BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D06f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC091496-1|AAH91496.1| 620|Homo sapiens FBXO21 protein protein. 47 5e-05 BC042333-1|AAH42333.1| 477|Homo sapiens FBXO21 protein protein. 47 5e-05 BC034045-1|AAH34045.1| 537|Homo sapiens FBXO21 protein protein. 47 5e-05 AF174601-1|AAF04522.1| 621|Homo sapiens F-box protein Fbx21 pro... 47 5e-05 AB020682-1|BAA74898.1| 621|Homo sapiens KIAA0875 protein protein. 47 5e-05 AK126100-1|BAC86439.1| 1197|Homo sapiens protein ( Homo sapiens ... 30 4.3 AL513550-4|CAI17194.1| 805|Homo sapiens RP11-98I9.2 protein. 30 5.7 AL080186-1|CAB45767.1| 299|Homo sapiens hypothetical protein pr... 30 5.7 AF314185-1|AAL76164.1| 283|Homo sapiens SR rich protein protein. 30 5.7 AF314184-1|AAL76163.1| 805|Homo sapiens SR rich protein protein. 30 5.7 U43416-1|AAA86260.1| 861|Homo sapiens replication control prote... 29 9.9 U40152-1|AAC50325.1| 861|Homo sapiens HsORC1 protein. 29 9.9 BC024001-1|AAH24001.1| 184|Homo sapiens leucine rich repeat con... 29 9.9 BC011539-1|AAH11539.1| 861|Homo sapiens origin recognition comp... 29 9.9 AY358318-1|AAQ88684.1| 184|Homo sapiens LKKM2429 protein. 29 9.9 AL513218-8|CAI12288.1| 861|Homo sapiens origin recognition comp... 29 9.9 AL355138-5|CAI12602.1| 175|Homo sapiens leucine rich repeat con... 29 9.9 AL355138-3|CAI12600.1| 184|Homo sapiens leucine rich repeat con... 29 9.9 AL355138-2|CAI12603.1| 128|Homo sapiens leucine rich repeat con... 29 9.9 AK094734-1|BAC04409.1| 184|Homo sapiens protein ( Homo sapiens ... 29 9.9 AK001613-1|BAA91789.1| 128|Homo sapiens protein ( Homo sapiens ... 29 9.9 AJ272268-1|CAB75962.1| 997|Homo sapiens calcium channel alpha2-... 29 9.9 AF516696-1|AAN06673.1| 1091|Homo sapiens voltage-gated calcium c... 29 9.9 >BC091496-1|AAH91496.1| 620|Homo sapiens FBXO21 protein protein. Length = 620 Score = 46.8 bits (106), Expect = 5e-05 Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 70 ERQVLAAVSYVIYGQECIQVSATANLDTLDIT--KILLNKRGSVLAVACIYHAVAKRCGV 243 + QVL A++YV+Y Q + + + L++ ++L+ + G ++++ +Y +A++ GV Sbjct: 257 QSQVLDAMNYVLYDQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGV 316 Query: 244 ACDVVAFPNHFFLEW 288 + V FP+HF L W Sbjct: 317 PLEPVNFPSHFLLRW 331 >BC042333-1|AAH42333.1| 477|Homo sapiens FBXO21 protein protein. Length = 477 Score = 46.8 bits (106), Expect = 5e-05 Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 70 ERQVLAAVSYVIYGQECIQVSATANLDTLDIT--KILLNKRGSVLAVACIYHAVAKRCGV 243 + QVL A++YV+Y Q + + + L++ ++L+ + G ++++ +Y +A++ GV Sbjct: 174 QSQVLDAMNYVLYDQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGV 233 Query: 244 ACDVVAFPNHFFLEW 288 + V FP+HF L W Sbjct: 234 PLEPVNFPSHFLLRW 248 >BC034045-1|AAH34045.1| 537|Homo sapiens FBXO21 protein protein. Length = 537 Score = 46.8 bits (106), Expect = 5e-05 Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 70 ERQVLAAVSYVIYGQECIQVSATANLDTLDIT--KILLNKRGSVLAVACIYHAVAKRCGV 243 + QVL A++YV+Y Q + + + L++ ++L+ + G ++++ +Y +A++ GV Sbjct: 174 QSQVLDAMNYVLYDQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGV 233 Query: 244 ACDVVAFPNHFFLEW 288 + V FP+HF L W Sbjct: 234 PLEPVNFPSHFLLRW 248 >AF174601-1|AAF04522.1| 621|Homo sapiens F-box protein Fbx21 protein. Length = 621 Score = 46.8 bits (106), Expect = 5e-05 Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 70 ERQVLAAVSYVIYGQECIQVSATANLDTLDIT--KILLNKRGSVLAVACIYHAVAKRCGV 243 + QVL A++YV+Y Q + + + L++ ++L+ + G ++++ +Y +A++ GV Sbjct: 258 QSQVLDAMNYVLYDQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGV 317 Query: 244 ACDVVAFPNHFFLEW 288 + V FP+HF L W Sbjct: 318 PLEPVNFPSHFLLRW 332 >AB020682-1|BAA74898.1| 621|Homo sapiens KIAA0875 protein protein. Length = 621 Score = 46.8 bits (106), Expect = 5e-05 Identities = 22/75 (29%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 70 ERQVLAAVSYVIYGQECIQVSATANLDTLDIT--KILLNKRGSVLAVACIYHAVAKRCGV 243 + QVL A++YV+Y Q + + + L++ ++L+ + G ++++ +Y +A++ GV Sbjct: 258 QSQVLDAMNYVLYDQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGV 317 Query: 244 ACDVVAFPNHFFLEW 288 + V FP+HF L W Sbjct: 318 PLEPVNFPSHFLLRW 332 >AK126100-1|BAC86439.1| 1197|Homo sapiens protein ( Homo sapiens cDNA FLJ44112 fis, clone TESTI4046282. ). Length = 1197 Score = 30.3 bits (65), Expect = 4.3 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Frame = -1 Query: 476 VVQLSCTPIELRYEESICCNNFSGQYLRIFFWFVGLAENGQRLFD--FNSPFSRSTLYSC 303 + Q C E Y E I C NF G+ L+I + N L +S +SR+ C Sbjct: 230 ITQQPCARYEAEYGEKITCRNFIGKQLKINSSTIEATSNCTDLLKMLISSEYSRAKALVC 289 Query: 302 PSV 294 V Sbjct: 290 VPV 292 >AL513550-4|CAI17194.1| 805|Homo sapiens RP11-98I9.2 protein. Length = 805 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 Query: 256 PHRKRRRSASLLRDRCTPRLKRSR 185 P R+RRRS S RDR T R RSR Sbjct: 612 PSRERRRSRSRSRDRRTNRASRSR 635 >AL080186-1|CAB45767.1| 299|Homo sapiens hypothetical protein protein. Length = 299 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 Query: 256 PHRKRRRSASLLRDRCTPRLKRSR 185 P R+RRRS S RDR T R RSR Sbjct: 106 PSRERRRSRSRSRDRRTNRASRSR 129 >AF314185-1|AAL76164.1| 283|Homo sapiens SR rich protein protein. Length = 283 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 Query: 256 PHRKRRRSASLLRDRCTPRLKRSR 185 P R+RRRS S RDR T R RSR Sbjct: 90 PSRERRRSRSRSRDRRTNRASRSR 113 >AF314184-1|AAL76163.1| 805|Homo sapiens SR rich protein protein. Length = 805 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 Query: 256 PHRKRRRSASLLRDRCTPRLKRSR 185 P R+RRRS S RDR T R RSR Sbjct: 612 PSRERRRSRSRSRDRRTNRASRSR 635 >U43416-1|AAA86260.1| 861|Homo sapiens replication control protein 1 protein. Length = 861 Score = 29.1 bits (62), Expect = 9.9 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = -2 Query: 376 LDSLKTGSASSTLTPHFRGPLYILVHQCRATPGRNDSETQPHRKRRRSASLLRDRCTPRL 197 L + G SS + P I + +N++ + PHR RR+S+ L +R +L Sbjct: 336 LTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQL 395 Query: 196 K 194 + Sbjct: 396 R 396 >U40152-1|AAC50325.1| 861|Homo sapiens HsORC1 protein. Length = 861 Score = 29.1 bits (62), Expect = 9.9 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = -2 Query: 376 LDSLKTGSASSTLTPHFRGPLYILVHQCRATPGRNDSETQPHRKRRRSASLLRDRCTPRL 197 L + G SS + P I + +N++ + PHR RR+S+ L +R +L Sbjct: 336 LTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQL 395 Query: 196 K 194 + Sbjct: 396 R 396 >BC024001-1|AAH24001.1| 184|Homo sapiens leucine rich repeat containing 20 protein. Length = 184 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >BC011539-1|AAH11539.1| 861|Homo sapiens origin recognition complex, subunit 1-like (yeast) protein. Length = 861 Score = 29.1 bits (62), Expect = 9.9 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = -2 Query: 376 LDSLKTGSASSTLTPHFRGPLYILVHQCRATPGRNDSETQPHRKRRRSASLLRDRCTPRL 197 L + G SS + P I + +N++ + PHR RR+S+ L +R +L Sbjct: 336 LTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQL 395 Query: 196 K 194 + Sbjct: 396 R 396 >AY358318-1|AAQ88684.1| 184|Homo sapiens LKKM2429 protein. Length = 184 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >AL513218-8|CAI12288.1| 861|Homo sapiens origin recognition complex, subunit 1-like (yeast) protein. Length = 861 Score = 29.1 bits (62), Expect = 9.9 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = -2 Query: 376 LDSLKTGSASSTLTPHFRGPLYILVHQCRATPGRNDSETQPHRKRRRSASLLRDRCTPRL 197 L + G SS + P I + +N++ + PHR RR+S+ L +R +L Sbjct: 336 LTPISGGQRSSVVPSVILKPENIKKRDAKEAKAQNEATSTPHRIRRKSSVLTMNRIRQQL 395 Query: 196 K 194 + Sbjct: 396 R 396 >AL355138-5|CAI12602.1| 175|Homo sapiens leucine rich repeat containing 20 protein. Length = 175 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >AL355138-3|CAI12600.1| 184|Homo sapiens leucine rich repeat containing 20 protein. Length = 184 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >AL355138-2|CAI12603.1| 128|Homo sapiens leucine rich repeat containing 20 protein. Length = 128 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >AK094734-1|BAC04409.1| 184|Homo sapiens protein ( Homo sapiens cDNA FLJ37415 fis, clone BRAWH2000232. ). Length = 184 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >AK001613-1|BAA91789.1| 128|Homo sapiens protein ( Homo sapiens cDNA FLJ10751 fis, clone NT2RP3004466. ). Length = 128 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 247 CDVVAFPNHFFLEWRDTDGQEYKVDLENGELKS 345 C +V+FP + R+ GQ + + L N ELKS Sbjct: 32 CKLVSFPIGIYKVLRNVSGQIHLITLANNELKS 64 >AJ272268-1|CAB75962.1| 997|Homo sapiens calcium channel alpha2-delta3 subunit protein. Length = 997 Score = 29.1 bits (62), Expect = 9.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 476 VVQLSCTPIELRYEESICCNNFSGQYLR 393 V ++ PIE+RY ES+ C Q +R Sbjct: 928 VAPITMAPIEIRYNESLKCERLKAQKIR 955 >AF516696-1|AAN06673.1| 1091|Homo sapiens voltage-gated calcium channel alpha(2)delta-3 subunit protein. Length = 1091 Score = 29.1 bits (62), Expect = 9.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 476 VVQLSCTPIELRYEESICCNNFSGQYLR 393 V ++ PIE+RY ES+ C Q +R Sbjct: 1022 VAPITMAPIEIRYNESLKCERLKAQKIR 1049 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,895,676 Number of Sequences: 237096 Number of extensions: 1602084 Number of successful extensions: 4181 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 3962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4169 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -