BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D06f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 27 0.088 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 7.7 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 27.5 bits (58), Expect = 0.088 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = +3 Query: 333 GVKVEEALPVFSESNKP--EKYTQILSREV 416 G+K++E LP F SNKP ++Y +LS + Sbjct: 354 GMKIKEELPHFVGSNKPVKDEYMLVLSNRM 383 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 89 AASTCRSVRRPCEHFSWAVRVFHCVESD 6 +AST RS + C + + + HC + D Sbjct: 726 SASTARSEQFLCRYEAHCFALCHCCDFD 753 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 254 WLRFRIISSWSG 289 WL F +++ WSG Sbjct: 348 WLPFFVVNLWSG 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,750 Number of Sequences: 438 Number of extensions: 3209 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -