BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D03f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0320 - 14347195-14347443,14347573-14347674,14347747-143478... 28 5.2 11_06_0757 + 26964983-26965048,26965470-26965874,26966921-269678... 27 9.1 >06_02_0320 - 14347195-14347443,14347573-14347674,14347747-14347851, 14347938-14348084,14348171-14348290,14348743-14348878, 14349198-14349328,14350854-14350928,14351040-14351139, 14351213-14351385,14351474-14351581,14351674-14351791, 14353477-14353970 Length = 685 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -3 Query: 267 SLICDVLDEHTNVLPHRR--RCQPKRGRSGIREGQ-WFD 160 + + + DEH NV+P+ + C K G +G+ G+ WF+ Sbjct: 262 AFVAQIRDEHENVMPNIQIADCGHKIGLNGVDNGRIWFN 300 >11_06_0757 + 26964983-26965048,26965470-26965874,26966921-26967814, 26972063-26972512,26973013-26973637,26994014-26994651, 26994967-26995032 Length = 1047 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 168 IALHEYLISLSSADTDACGAKH*CVHQGHH 257 I LH S+SS + C A C H GHH Sbjct: 754 IHLHLPAASVSSLECGYCDAATVCDHHGHH 783 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,543,137 Number of Sequences: 37544 Number of extensions: 277247 Number of successful extensions: 643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -