BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D03f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50030.1 68416.m05470 hypothetical protein 28 3.3 At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) 28 4.4 At5g43950.1 68418.m05377 expressed protein 27 7.7 >At3g50030.1 68416.m05470 hypothetical protein Length = 501 Score = 28.3 bits (60), Expect = 3.3 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = +1 Query: 412 EKNSIQQCLHICWSCTENIYXKCCGIQQSGRIK 510 E+ ++ + I +C +N+Y G++ GR+K Sbjct: 167 EEEIVKLAMEIATNCLKNVYKSFLGVEDRGRLK 199 >At4g36870.1 68417.m05228 BEL1-like homeobox 2 protein (BLH2) Length = 638 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 134 GINSITNSQTITAVTWHSSSWMQDQQ*NHSTNEH 33 GI + + TI T+H++S QD +H N+H Sbjct: 2 GITKTSPNTTILLKTFHNNSMSQDYHHHHHHNQH 35 >At5g43950.1 68418.m05377 expressed protein Length = 566 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 149 EVVASNHCPSRIPDLPLFG*HRRLWGKTLVCSSRTSQIRLNSSL 280 E+VA+ + + + P G + R WG +V +SR+ +LN L Sbjct: 484 EIVAAEYLRGAVVEPPWLG-YMREWGPKIVYNSRSEIEKLNERL 526 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,990,996 Number of Sequences: 28952 Number of extensions: 223229 Number of successful extensions: 496 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -