BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309D01f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY128415-1|AAM75008.1| 310|Drosophila melanogaster GH05248p pro... 29 2.9 AE014297-2784|AAF55759.2| 272|Drosophila melanogaster CG4342-PA... 29 2.9 >AY128415-1|AAM75008.1| 310|Drosophila melanogaster GH05248p protein. Length = 310 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -3 Query: 354 LLKESVENTAIVAIVSNR*NKK*QYHISLKI*LYCENLKVEVVWTLGTSLAQRNVH 187 L KE E TAI+ +S++ N + S ++ + +VEVVW TS A R+ H Sbjct: 220 LRKEKDECTAILKTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGH 275 >AE014297-2784|AAF55759.2| 272|Drosophila melanogaster CG4342-PA protein. Length = 272 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = -3 Query: 354 LLKESVENTAIVAIVSNR*NKK*QYHISLKI*LYCENLKVEVVWTLGTSLAQRNVH 187 L KE E TAI+ +S++ N + S ++ + +VEVVW TS A R+ H Sbjct: 182 LRKEKDECTAILKTISHQINSEHSELQSHRLLSIFKMSEVEVVWPESTSAAARSGH 237 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,522,574 Number of Sequences: 53049 Number of extensions: 418190 Number of successful extensions: 1247 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -