BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309C12f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0129 - 26770543-26770720,26774592-26774719,26774829-267749... 28 5.2 02_01_0342 + 2451314-2451345,2451536-2451730,2452548-2452587 27 9.1 >01_06_0129 - 26770543-26770720,26774592-26774719,26774829-26774933, 26775661-26775788,26777332-26777433,26778760-26778861, 26779777-26779852,26779971-26780059,26780177-26780230, 26780482-26780614,26780671-26780797,26781590-26781648 Length = 426 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 214 PAVPEISRNKQTDRQKFKKML-FWCI*YIYMHVVKSGY 324 P VPEI+ +TDR K++ W YM++ GY Sbjct: 342 PLVPEIAHMYKTDRHKYENTARTWTQSSSYMYIFTYGY 379 >02_01_0342 + 2451314-2451345,2451536-2451730,2452548-2452587 Length = 88 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 290 YIHQNNIFLNFCLSVCLFRLISGTAGP 210 Y+H+ IF NFC S+ F LI P Sbjct: 26 YMHRLEIFSNFCSSLVTFLLIEHLKKP 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,721,553 Number of Sequences: 37544 Number of extensions: 207485 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -