BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309C11f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 24 0.94 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 1.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 2.9 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 2.9 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 23.8 bits (49), Expect = 0.94 Identities = 15/75 (20%), Positives = 32/75 (42%) Frame = +2 Query: 266 RHDQPQTINYAAPVAKLAVATPVTYHAAPAPVTYHAAPAAVSYHSAPVAKIVAHQAEEIA 445 +H+Q Q++ ++ + + P+ +P PV+ + + S S+P H + Sbjct: 130 QHNQQQSVEKSSKLKNKSA--PILTKTSPTPVSINNNTSTSSSASSPSVTAAPHLRDSPN 187 Query: 446 YPKYEYNYSVADGHS 490 Y K + + S S Sbjct: 188 YIKPQLHVSTGSTSS 202 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 77 SSGPVPPGD 51 SSGP PPGD Sbjct: 275 SSGPAPPGD 283 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 2.9 Identities = 12/47 (25%), Positives = 18/47 (38%) Frame = -1 Query: 206 TLQGQHGKPQGQRGKLQEPQRHNEHRGFRHGVRCSGRKLPQQMSSGP 66 T Q + G + Q PQ H H +H + G++ GP Sbjct: 158 TTQSMNNHHMGHHMQEQHPQHHQPHHQQQH-MMYGGQQGANMHQQGP 203 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.2 bits (45), Expect = 2.9 Identities = 12/47 (25%), Positives = 18/47 (38%) Frame = -1 Query: 206 TLQGQHGKPQGQRGKLQEPQRHNEHRGFRHGVRCSGRKLPQQMSSGP 66 T Q + G + Q PQ H H +H + G++ GP Sbjct: 160 TTQSMNNHHMGHHMQEQHPQHHQPHHQQQH-MMYGGQQGANMHQQGP 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,401 Number of Sequences: 336 Number of extensions: 1508 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -