BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309C08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13774| Best HMM Match : Cgr1 (HMM E-Value=0.74) 33 0.14 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 30 1.3 SB_46037| Best HMM Match : Pept_C1-like (HMM E-Value=0) 28 4.1 SB_34249| Best HMM Match : fn3 (HMM E-Value=0) 27 7.1 SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_13774| Best HMM Match : Cgr1 (HMM E-Value=0.74) Length = 668 Score = 33.1 bits (72), Expect = 0.14 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 450 PSNLSFIYYCRDMKT-YKTNFFCILKFYTSHGFNVRTQTILKFSTV 316 P L ++YY R+++T Y+ +FF +Y H FN + T+ FS + Sbjct: 581 PIGLLYVYYARNIRTKYQLDFFKRASYYDKHLFN-KYPTVALFSNL 625 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 372 YTSHGFNVRTQTILKFSTVPRYPKIFELDKRSWWVFVVIINNI 244 + HG T++ S P P F DK +W V + I+ +I Sbjct: 59 HQGHGATTTCSTLISLSGWPHNPLTFNTDKLAWSVRLAILQHI 101 >SB_46037| Best HMM Match : Pept_C1-like (HMM E-Value=0) Length = 605 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 450 PSNLSFIYYCRDMKTYKTNFFCILKFYTSH 361 P+N ++ YY +D +K L+FYT H Sbjct: 231 PANFTWEYYDKDKNFFKLEDITPLQFYTEH 260 >SB_34249| Best HMM Match : fn3 (HMM E-Value=0) Length = 2195 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 229 DILEGNVVDYYNKDPPTSFIEFKDFWISWHS 321 D G VD Y D PT + FK F +W S Sbjct: 332 DYFTGTAVDVYPLDQPTDIVNFKRF--AWGS 360 >SB_19212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 513 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 336 ILKFSTVPRYPKIFELDKRSWWVFVVIINNITL 238 + + T P+YP++ W+V V II N +L Sbjct: 399 VTELPTQPKYPRVSAWALNKWFVAVTIIRNPSL 431 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,803,831 Number of Sequences: 59808 Number of extensions: 338457 Number of successful extensions: 677 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -