BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309C01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 28 0.73 SPAC4F8.08 |mug114||sequence orphan|Schizosaccharomyces pombe|ch... 28 0.97 SPAC22F3.12c |rgs1||regulator of G-protein signaling Rgs1|Schizo... 27 1.7 SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharo... 26 3.0 SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 25 5.2 SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|... 25 5.2 SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce... 25 6.8 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 28.3 bits (60), Expect = 0.73 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 485 RDCIYRRVSLHKNWLPRPWCYFQPSPWLPQRCP 387 RD + + LH N PR C+FQPS + P Sbjct: 463 RDNLRQHERLHVNASPRLACFFQPSGYYSSGAP 495 >SPAC4F8.08 |mug114||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 27.9 bits (59), Expect = 0.97 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 380 KEKGIFVVAKEKVGNNTRVWEASSYVK 460 K+ G+F +AK K+ N T+VW + Y K Sbjct: 4 KKGGLFKIAK-KLRNGTKVWARAGYFK 29 >SPAC22F3.12c |rgs1||regulator of G-protein signaling Rgs1|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 27.1 bits (57), Expect = 1.7 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +1 Query: 229 TVPLCSG-CWCGPLRTAMGLSL-SIPSIKTGSNHLCVIIFHTDGYFDPLHYIQREGHLCG 402 T+P + C C A L + + PS + SN C++ GY ++Q GH Sbjct: 115 TIPKTAAKCLCNTFLNARLLQIVNNPSARKFSNEKCLLQLTRKGYSVVSEFLQHNGH--N 172 Query: 403 SQGE 414 SQ E Sbjct: 173 SQAE 176 >SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 508 Score = 26.2 bits (55), Expect = 3.0 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 246 WLLVWPFTHCYGIIFIHSLN-QDW 314 W++V Y ++F HSLN +DW Sbjct: 162 WIMVVVLAQKYKVLFYHSLNLRDW 185 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 25.4 bits (53), Expect = 5.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 481 IVFIVVFLYIRTGFPDPGVISNL 413 I F + LY+RT F +PG + + Sbjct: 355 ISFTCIGLYVRTAFQNPGYVDKI 377 >SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 540 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 463 TRR*IQSRNCYARHEWQHS 519 T R QSRNC+ H++Q+S Sbjct: 18 TGRKCQSRNCFFSHDFQNS 36 >SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1242 Score = 25.0 bits (52), Expect = 6.8 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = +2 Query: 362 TLYTTFKEKGIFVVAKEKVGNNTRVWEASSYVKKHDDKYNLVIVMRDT 505 T++ K +GIF + ++V NN W D Y +I T Sbjct: 527 TVFVKLKLQGIFSSSFQQVSNNMYSWIYDHVFSSSDHAYESLIYYMKT 574 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,046,067 Number of Sequences: 5004 Number of extensions: 39984 Number of successful extensions: 112 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -