BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309B09f (347 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 3.6 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 4.8 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 4.8 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.0 bits (42), Expect = 3.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 205 CKFFSIQNYVRLT 243 CKFFSI N + L+ Sbjct: 410 CKFFSIDNALLLS 422 Score = 20.2 bits (40), Expect = 6.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 205 CKFFSIQN 228 CKFFSI N Sbjct: 357 CKFFSIDN 364 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 20.6 bits (41), Expect = 4.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 14 GLRRG*AQRPSQLVHGSRRIHRARRGCLHR 103 G R A SQLV R HR++ C R Sbjct: 85 GKRARTAYTSSQLVELEREFHRSKYLCRPR 114 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 20.6 bits (41), Expect = 4.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 14 GLRRG*AQRPSQLVHGSRRIHRARRGCLHR 103 G R A SQLV R HR++ C R Sbjct: 105 GKRARTAYTSSQLVELEREFHRSKYLCRPR 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,485 Number of Sequences: 336 Number of extensions: 380 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -