BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309B04f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 79 4e-17 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 1.4 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 1.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 3.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 5.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 78.6 bits (185), Expect = 4e-17 Identities = 45/137 (32%), Positives = 79/137 (57%), Gaps = 9/137 (6%) Frame = +3 Query: 135 QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKTATFSI 314 Q +E+F+ L+ +L I G++KP+ +Q+ A+ + GRD++A AQ+G+GKTA F++ Sbjct: 193 QPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSGKTAAFAV 252 Query: 315 SIL-----QQIDTSIR----ECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 467 I+ + +D + E Q +I++PTREL QI + ++ + K GGT+ Sbjct: 253 PIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLNSILKTVVAYGGTS 312 Query: 468 VREDIRQLESGVHVVVA 518 V +L +G H++VA Sbjct: 313 VMHQRGKLSAGCHILVA 329 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 280 SQELEKLLLSLYRFYNKSIQAFVNV 354 S++ E+L+ L+R YNK I+ N+ Sbjct: 24 SEDEERLVRDLFRGYNKLIRPVQNM 48 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 471 GHWCHQCKHGI*HSS 427 G CH+CK+GI SS Sbjct: 40 GDSCHKCKYGIAMSS 54 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +2 Query: 164 PQRRIVERHIRLWF*KTFC----NPATRNNAL 247 P +++ I WF TFC N AT NA+ Sbjct: 521 PDKQLTLNEIYNWFQNTFCYFRRNAATWKNAV 552 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.2 bits (45), Expect = 3.3 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 Query: 449 LHWWHQCP 472 LH WH CP Sbjct: 470 LHHWHHCP 477 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = -3 Query: 516 PPPHEHHSPVGEYLHGHW 463 PP H HH H H+ Sbjct: 349 PPHHHHHHQTQSLQHLHY 366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,951 Number of Sequences: 438 Number of extensions: 4004 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -