BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309B03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Ma... 55 6e-09 SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomy... 28 0.97 SPAC20G8.03 |itr2||MFS myo-inositol transporter|Schizosaccharomy... 25 5.2 >SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 55.2 bits (127), Expect = 6e-09 Identities = 25/76 (32%), Positives = 41/76 (53%) Frame = +3 Query: 18 EDESLLTSGGVTIAGTRYIYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQA 197 +D + G+ +AG +YI + I KL K G+ C+ T+ +++S Y E P +A Sbjct: 52 QDPPSMFGTGIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEA 111 Query: 198 ASVVEKLGEYLITCGY 245 A + E L +YL+ GY Sbjct: 112 AKITEALADYLVGVGY 127 >SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 27.9 bits (59), Expect = 0.97 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +1 Query: 403 SLVCTCDYFVD--SGPFLYAHR---LLKXXXXXXXXKFVLKFCF 519 +++C C+YF+D +GPFL +++ +L + VLKF + Sbjct: 322 AIMCRCEYFLDMLAGPFLESNQELPVLSLPFSSSVVEIVLKFLY 365 >SPAC20G8.03 |itr2||MFS myo-inositol transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 557 Score = 25.4 bits (53), Expect = 5.2 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 255 KLAVI*EYYKIIFFPRGNK*LHFVYSIK 338 K+++I E K+ F P GNK HF +S+K Sbjct: 295 KVSLIQEGVKVDF-PEGNKFQHFFHSLK 321 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,227,126 Number of Sequences: 5004 Number of extensions: 45617 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -