BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309B03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 138 3e-35 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 2.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.7 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 138 bits (334), Expect = 3e-35 Identities = 61/76 (80%), Positives = 71/76 (93%) Frame = +3 Query: 18 EDESLLTSGGVTIAGTRYIYLSGTDHIIRAKLGKVGVHCMKTQQAVVISLYEEPIQPQQA 197 E++ +LTS GVT+AG RYIYLSGTD +IRAKLGKVGVHCMKT QAVV+SLYE+PIQPQQA Sbjct: 51 EEQDILTSSGVTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQA 110 Query: 198 ASVVEKLGEYLITCGY 245 ASVVEKLG+YL++CGY Sbjct: 111 ASVVEKLGDYLVSCGY 126 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 185 LDGFFIERNDHSLLCLH 135 + G IER DH++LC++ Sbjct: 327 ISGAPIERPDHAVLCVY 343 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +3 Query: 129 HCMKTQQAVVIS 164 HC+ T+Q+VV++ Sbjct: 822 HCVTTEQSVVVT 833 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,607 Number of Sequences: 438 Number of extensions: 3189 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -