BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 27 0.38 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 0.88 AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein pro... 26 0.88 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 1.2 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 2.7 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 3.6 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 24 3.6 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 4.7 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 4.7 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 23 6.2 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 23 6.2 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 23 6.2 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 23 6.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 8.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 8.2 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 8.2 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 8.2 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 27.1 bits (57), Expect = 0.38 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 330 GLGPSFLESSSLSVTGETGEVSSCRTGVTEACTRV 226 G+G F L++ G TG V T V E C +V Sbjct: 567 GIGYGFFSGQPLTILGSTGPVLVFETIVYEFCQKV 601 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 0.88 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = +2 Query: 197 HHTMQPALVATLVHASVTPVLQEDTSPVSPVT------DKEDDSRKDGPSPELENGG 349 ++ M+ +++T + + + +ED P +P T ++E+ R G +PE E+GG Sbjct: 1514 YNNMRTGVISTAIPEANS---EEDIVPPAPATATTKSVEREEPVRASGKAPESESGG 1567 >AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein protein. Length = 182 Score = 25.8 bits (54), Expect = 0.88 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 293 DKEDDSRKDGPSPELENGGDRKGDSQS 373 D E + KD + E GG+ GDS S Sbjct: 125 DDETEESKDDAEEDSEEGGEEGGDSAS 151 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 25.4 bits (53), Expect = 1.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 180 LHLSPYITQCNPLSSRLWYT 239 + L Y C PLSSR W T Sbjct: 202 ISLERYFAICRPLSSRRWQT 221 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 290 TDKEDDSRKDGPSPELEN 343 +DKEDD DG ++EN Sbjct: 1728 SDKEDDDGDDGEDDDVEN 1745 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 201 TQCNPLSSRLWYTPL 245 TQCNPLS+ L+ T L Sbjct: 28 TQCNPLSTYLYRTIL 42 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.8 bits (49), Expect = 3.6 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 94 AHAARTYAPARSSARQS-TAPAAACHARRPSTSARTSHNATRS 219 A AA A ++A + TAPAA + + +A T+H AT S Sbjct: 198 AFAATNAASVATAAPAAITAPAANAASTAAAPAAATAHAATAS 240 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQNYWDRL 161 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQNYWDRL 161 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 125 IEARKYPVLRYRFETMDDLQDYWDRL 150 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 125 IEARKYPVLRYRFETMDDLQDYWDRL 150 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 377 IDSGSLPYGRHRSLTLDSVHLFWNRL 300 I++ P R+R T+D + +W+RL Sbjct: 136 IEARKYPVLRYRFETMDDLQDYWDRL 161 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 275 PVSPVTDKEDDSRKDGPSP 331 P+SP+ K++ DGP P Sbjct: 70 PISPLHIKQEPLGSDGPMP 88 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 275 PVSPVTDKEDDSRKDGPSP 331 P+SP+ K++ DGP P Sbjct: 70 PISPLHIKQEPLGSDGPMP 88 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 22.6 bits (46), Expect = 8.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 88 TRAHAARTYAPARSSARQSTAPAAACHARRPSTSARTSHNATRSRRDSGTR 240 +R+ +A + S +S + A+ R S S S + +RSR SG+R Sbjct: 1134 SRSQSAGSRKSGSRSRSRSGSQASRGSRRSRSRSRSRSGSRSRSRSGSGSR 1184 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 221 VATLVHASVTPVLQEDTS 274 V L HA V+PV +DTS Sbjct: 294 VTVLGHAKVSPVPADDTS 311 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,646 Number of Sequences: 2352 Number of extensions: 7621 Number of successful extensions: 105 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -