BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 1.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 1.9 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 22 4.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.7 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 381 PCVRVQRIKDYFEARKLLYYVMSA 310 P R+QR+ D+F LL + ++A Sbjct: 49 PLDRLQRVVDWFRKNMLLVFTIAA 72 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.0 bits (47), Expect = 1.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 151 WLGLVSAALACELNPGPGVGSKSPGD 228 +L S LA E PG GSK P D Sbjct: 42 FLQCASLKLAFEPRRNPGPGSKGPRD 67 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 392 LGALLVSGFKGSRIILKPANCC 327 L A++VSG KGS I + C Sbjct: 227 LKAMVVSGSKGSNINISQVIAC 248 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 Query: 199 DLDLARRPVPRTLGPATLKFSDCPFYLGLRRT 104 D D R P AT + PF +G RRT Sbjct: 383 DSDGIRLPCREVEAAATARNVVAPFLIGSRRT 414 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 317 MT*YNSLRASK*SLIL*TRTQGGRP 391 +T YN + S +L TRT+G +P Sbjct: 1437 VTAYNGIGTGDPSDMLNTRTKGSKP 1461 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.316 0.136 0.405 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,661 Number of Sequences: 438 Number of extensions: 2618 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -