BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A09f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 23 1.6 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 5.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 6.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.7 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 23.0 bits (47), Expect = 1.6 Identities = 26/94 (27%), Positives = 38/94 (40%) Frame = -3 Query: 399 DTSCPARGSXXXXXFIENFYSIMSRTLLHSIYLGLCT*ILKNYFSGFRCFRGLQIFIKFV 220 +T+C S I N+Y I+ T+ I+ N G++ L IF + Sbjct: 208 ETACEQSKSVEELMNIANYYRILGDTV--EIF---------NSLFGYQII--LVIFDCCL 254 Query: 219 EAVYHRAKVFLNSLRGQGGFNFFPQFLNCFLRTL 118 E V FL ++ GQG FN N L T+ Sbjct: 255 ETVSALNGAFLYTINGQGQFNIEMFLCNMSLLTV 288 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 462 LQYIGFVSIINYH*YLQWR*TDTSCP 385 L Y+ + YH + W T T+CP Sbjct: 241 LTYLIWTIYEMYHLAILWSCTSTNCP 266 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 160 ESALAPETVKKNFGTMVDSFN 222 + LA T+K+NF T ++ N Sbjct: 686 DELLAQPTIKENFHTALEIMN 706 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 88 KEDNSLNTLAESAKKTIEELREKVES 165 K DN N ++++ +L K+ES Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIES 1118 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 88 KEDNSLNTLAESAKKTIEELREKVES 165 K DN N ++++ +L K+ES Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIES 1118 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 8.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 355 HRKLLFNNVENIITFDIFGVMYLDTKKLLLRLSVLPR 245 HRK + ++ I+ FDI ++ KK + V+ R Sbjct: 1179 HRKKIVKFLDGIMAFDIQLKQVVNYKKKKFQRMVVAR 1215 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,434 Number of Sequences: 336 Number of extensions: 2123 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -