BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A08f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 2.2 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 6.6 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +2 Query: 104 CWSTYTLTTPAYYFCVLVDILNYIFSMLIARTC 202 CWS +T T + + VDI + ++ I C Sbjct: 233 CWSEFTQKTQGQIYGIKVDIRDAYGNVKIPVLC 265 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 119 TLTTPAYYFCVLVDILNYIFSML 187 T+T +YF + +Y+F ML Sbjct: 332 TITRTMWYFQICGSAFSYLFIML 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,539 Number of Sequences: 336 Number of extensions: 2866 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -