BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A05f (387 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26) 27 7.1 >SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1205 Score = 27.1 bits (57), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 90 NHYTGTKYL*LIRNXTLIHNYFLYNRSDLRTKNYAF 197 ++Y GTKY +N + Y N DL+TK AF Sbjct: 653 DYYIGTKYSEYWKNIEEVLFYSTSNLKDLQTKTRAF 688 >SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26) Length = 776 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 219 VTVRVSFKKRNSWSLNRYDCTENNYVS 139 VT R +++ W+ N YD N Y+S Sbjct: 91 VTSRGKLEQKLKWAFNMYDLDGNGYIS 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,880,768 Number of Sequences: 59808 Number of extensions: 133549 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -