BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0913 + 22540078-22540166,22540280-22540420,22541151-225412... 31 0.74 01_01_0125 - 1154626-1154685,1155100-1155195,1155578-1155652,115... 29 2.3 01_01_1218 + 9846644-9847837 28 4.0 11_02_0010 + 7322826-7323658,7324236-7324714,7325204-7326195 27 6.9 10_08_0425 - 17806117-17806401,17806862-17806984,17807076-178072... 27 9.1 07_01_1023 + 8840754-8842988,8843189-8843362 27 9.1 >08_02_0913 + 22540078-22540166,22540280-22540420,22541151-22541281, 22542278-22542460,22542555-22543195 Length = 394 Score = 30.7 bits (66), Expect = 0.74 Identities = 24/96 (25%), Positives = 42/96 (43%) Frame = +1 Query: 127 EKNNHTFYSYKFMQIKINHQIKLLRFLRKYQSKVLRCEPTKEPIVDYGKTSLFEGFQITL 306 +K F Y+ + ++NH++ L R + + P + +Y +G + Sbjct: 11 QKQAPLFSPYQMPRFRLNHRVVLAPMTR---CRAIGGVPGPA-LAEYYAQRTTQGGLLIS 66 Query: 307 ENTILFPAGGGQPHDIGWLNDVEVLQVLRKGDEALH 414 E T++ PAG G PH G N E +K +A+H Sbjct: 67 EGTVVSPAGPGFPHVPGIYNQ-EQTDAWKKVVDAVH 101 >01_01_0125 - 1154626-1154685,1155100-1155195,1155578-1155652, 1155729-1155831,1155986-1156078,1156774-1156886, 1156981-1157124,1157247-1157357 Length = 264 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 298 ITLENTILFPAGGGQPHDIG 357 + +++T+ +P GGGQP D G Sbjct: 45 VLVDSTVFYPQGGGQPADTG 64 >01_01_1218 + 9846644-9847837 Length = 397 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 343 PHDIGWLNDVEVLQVLRKGDEALH 414 PH IG L D++ L V GD+ H Sbjct: 120 PHGIGQLTDLQTLTVFNTGDDLSH 143 >11_02_0010 + 7322826-7323658,7324236-7324714,7325204-7326195 Length = 767 Score = 27.5 bits (58), Expect = 6.9 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Frame = -3 Query: 213 LSQESEKLYLMVYFNLHKLVTI----KRVVIFFLTDSLERLFQRNLN**VSSRGSNLTTL 46 L +E + +Y KLV I K ++ +F ++ +E + QR + V G TTL Sbjct: 156 LCREIDPRLPALYVEKEKLVGIQGPMKEIINWFGSEEVEPIGQRKIVSIVGQGGLGKTTL 215 Query: 45 PTQTYHRIE 19 Q Y +I+ Sbjct: 216 ANQVYQKIK 224 >10_08_0425 - 17806117-17806401,17806862-17806984,17807076-17807222, 17807307-17807450,17808557-17808668,17808762-17808898, 17809016-17809156,17810921-17811004,17811275-17811742, 17811858-17811936,17812494-17812506,17813884-17814460, 17814502-17814774,17814899-17815045,17815354-17815413, 17816124-17816510 Length = 1058 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 452 LTSIPTSIGSRVKWSASSPFRRTCNTSTSFNQP 354 + S P S+ R ++SPF +T + T+F QP Sbjct: 360 ILSAPPSLLGRPMTPSASPFPQTSQSPTAFQQP 392 >07_01_1023 + 8840754-8842988,8843189-8843362 Length = 802 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 175 INHQIKLLRFLRKYQSKVLRCEPTKEPIVD 264 + H+++ FL K+Q ++L C K ++D Sbjct: 744 VKHELEEEHFLAKHQEEILNCNQRKLEVMD 773 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,083,480 Number of Sequences: 37544 Number of extensions: 282343 Number of successful extensions: 671 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -