BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS309A04f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 1.1 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 3.3 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 5.8 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.8 bits (49), Expect = 1.1 Identities = 16/56 (28%), Positives = 22/56 (39%) Frame = +1 Query: 178 NHQIKLLRFLRKYQSKVLRCEPTKEPIVDYGKTSLFEGFQITLENTILFPAGGGQP 345 N+ + + K SKV+ T IV T + E + EN L G G P Sbjct: 6 NYALDVSSAASKTSSKVMLTRGTVNDIVSRNITMVLENLLMNYENNQLPTHGKGTP 61 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 358 WLNDVEVLQVLRKGDEALHFTREPIDVGIEVKQKVN 465 W + EV + ++KG L ID IEV + N Sbjct: 499 WFDYSEVSKWVQKGQICLKEKENEIDFKIEVTEDCN 534 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 400 HLSGELATLQHHSTSRCHEAVHLL 329 +LS + +L +T C EA+H+L Sbjct: 374 NLSFDKQSLLKENTVTCQEAMHML 397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,725 Number of Sequences: 438 Number of extensions: 2892 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -