BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 33 0.008 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 33 0.008 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 31 0.023 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 31 0.023 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 31 0.023 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 31 0.023 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 31 0.023 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 29 0.072 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 29 0.072 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 29 0.072 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 29 0.072 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 29 0.072 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 1.5 AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 25 2.0 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.2 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 6.2 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 8.2 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 32.7 bits (71), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 215 AEERFKEVAEAYEVLSDKKKREIYDAH 295 AE RF E+ ++YE+LSD ++R +D + Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQY 28 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 32.7 bits (71), Expect = 0.008 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 215 AEERFKEVAEAYEVLSDKKKREIYDAH 295 AE RF E+ ++YE+LSD ++R +D + Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQY 28 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 31.1 bits (67), Expect = 0.023 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKREIYDAH 295 E RF E+ ++YE+LSD ++R +D + Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQY 26 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.5 bits (63), Expect = 0.072 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +2 Query: 224 RFKEVAEAYEVLSDKKKREIYDAH 295 RF E+ ++YE+LSD ++R +D + Sbjct: 2 RFVEIKQSYELLSDSERRRAFDQY 25 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.0 bits (52), Expect = 1.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -1 Query: 497 DPYPHPCR 474 +PYPHPCR Sbjct: 334 EPYPHPCR 341 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 24.6 bits (51), Expect = 2.0 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 Query: 149 DIKKAYRKLALKYHPDKNKAAGAEERFKEVAEAYEVL 259 DI R + YHP G E FK+V +A VL Sbjct: 107 DIGTLMRSVTTYYHPILMGGEGKLEDFKKVQDAVGVL 143 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 100 AHFDLYCIRETLILDNLSTIYEILANNH 17 A FDL + ET ++DN+ + +L NN+ Sbjct: 104 ADFDLIALTETWLVDNIPS--ALLFNNN 129 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +2 Query: 164 YRKLALKYHPDKNKAAGAEERFKEVAEAYEVLSDKKKREI 283 +++ +KY+P K + E V A+E LS +++ ++ Sbjct: 514 FKQATIKYYPSKERWEMTMEDRTFVYGAWENLSKRREEDV 553 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 218 EERFKEVAEAYEVLSDKKKR 277 EE++KEV +V+ D KK+ Sbjct: 993 EEQYKEVMRRKKVVEDDKKK 1012 Score = 22.6 bits (46), Expect = 8.2 Identities = 13/67 (19%), Positives = 33/67 (49%), Gaps = 5/67 (7%) Frame = +2 Query: 77 NTIQIKMGKDYYKILGITKGASDDDIKKAYRKLALK-----YHPDKNKAAGAEERFKEVA 241 NT++ +G++ K+ + K DD+ A +++ ++ + K+ E+ F + Sbjct: 318 NTMKDSIGQEQRKLKNLQKSIRDDEQALAGKEVEMQRRGESFQALKDACEADEQAFAKAQ 377 Query: 242 EAYEVLS 262 + +E +S Sbjct: 378 KRFEAVS 384 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 437 RRMPGTGWP 411 RR PGT WP Sbjct: 233 RRFPGTAWP 241 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,930 Number of Sequences: 2352 Number of extensions: 9464 Number of successful extensions: 108 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -