BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H10f (515 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q05FK5 Cluster: DNA-directed RNA polymerase subunit alp... 34 2.2 UniRef50_A5CWS4 Cluster: N utilization substance protein B; n=2;... 33 2.9 UniRef50_Q9GUB6 Cluster: Serpentine receptor, class h protein 89... 32 6.8 >UniRef50_Q05FK5 Cluster: DNA-directed RNA polymerase subunit alpha; n=1; Candidatus Carsonella ruddii PV|Rep: DNA-directed RNA polymerase subunit alpha - Carsonella ruddii (strain PV) Length = 322 Score = 33.9 bits (74), Expect = 2.2 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 208 TVYKPNNIIMDVSGN*VY*CIIK*TNSL 291 T++ PN II +VS N V+ CI+K NSL Sbjct: 121 TIFNPNKIIANVSNNIVFYCIMKCVNSL 148 >UniRef50_A5CWS4 Cluster: N utilization substance protein B; n=2; sulfur-oxidizing symbionts|Rep: N utilization substance protein B - Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) Length = 141 Score = 33.5 bits (73), Expect = 2.9 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +2 Query: 131 RRLKWRKFPLLYEFVHTGGHILSL*KQYINQI--ILSWMFLATKFINVL*NKRIVYDK 298 +R + R LY+++ +GG + + +Q++NQ +S +F + FIN+L N R V D+ Sbjct: 8 QRTRERVIQALYQYLVSGGEVFQIEQQFLNQKQGKISKVFFSDLFINILEN-RFVLDE 64 >UniRef50_Q9GUB6 Cluster: Serpentine receptor, class h protein 89; n=1; Caenorhabditis elegans|Rep: Serpentine receptor, class h protein 89 - Caenorhabditis elegans Length = 343 Score = 32.3 bits (70), Expect = 6.8 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -3 Query: 279 LFYNTLINLVARNIHDNIIWFIYC-FYRLKICPPV*TNSYSNGNFLHF 139 +F +I L+ ++ I++FI C FY L + P + T+S + N HF Sbjct: 210 MFMAIVIPLLVSSVMSQILFFIVCSFYYLYLAPSLLTSSQTRSNQKHF 257 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,265,246 Number of Sequences: 1657284 Number of extensions: 8498801 Number of successful extensions: 14280 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14279 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31782822356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -