BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H10f (515 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0956 + 26296744-26297382,26297595-26297669,26298147-262983... 28 3.9 >06_03_0956 + 26296744-26297382,26297595-26297669,26298147-26298341, 26298426-26298559,26298713-26298779,26298985-26299043, 26299204-26299321,26299613-26299726,26299855-26299986, 26300076-26300492,26300904-26300954,26301303-26301373, 26302067-26302151,26302258-26302410,26302522-26302596, 26302755-26302844,26303953-26304000,26304081-26304195, 26305356-26305459,26305582-26305692 Length = 950 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 393 NK*IKISSKLGSPILRIYLLQKRSLGRTSLRCLS 292 N +K +S +G P+++ Y K + RTSL+CL+ Sbjct: 801 NHPVKWTSPVGLPVVQPYKKYKNYMIRTSLQCLA 834 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,495,112 Number of Sequences: 37544 Number of extensions: 208519 Number of successful extensions: 294 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -