BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H10f (515 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF078157-16|AAG24082.1| 343|Caenorhabditis elegans Serpentine r... 32 0.21 AF016678-3|AAB66150.2| 297|Caenorhabditis elegans Hypothetical ... 27 6.0 >AF078157-16|AAG24082.1| 343|Caenorhabditis elegans Serpentine receptor, class h protein89 protein. Length = 343 Score = 32.3 bits (70), Expect = 0.21 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -3 Query: 279 LFYNTLINLVARNIHDNIIWFIYC-FYRLKICPPV*TNSYSNGNFLHF 139 +F +I L+ ++ I++FI C FY L + P + T+S + N HF Sbjct: 210 MFMAIVIPLLVSSVMSQILFFIVCSFYYLYLAPSLLTSSQTRSNQKHF 257 >AF016678-3|AAB66150.2| 297|Caenorhabditis elegans Hypothetical protein K07E8.5 protein. Length = 297 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 356 PSYAYTYYKNAASVEPVCAVYHKLFVYFII 267 P+ AY Y A V PV AV+ VYF + Sbjct: 50 PTLAYLYVIGAPIVFPVAAVFQTSSVYFCV 79 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,855,894 Number of Sequences: 27780 Number of extensions: 216796 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -