BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H08f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 3.8 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 3.8 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 3.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 5.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.7 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.8 bits (44), Expect = 3.8 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 153 LFVRHRLVLFSERSYYYLSKIHTGYL-LTNSMKY 55 +F + V+ + R ++Y S + +GYL L +MK+ Sbjct: 93 IFAKGLNVIEANRLFFYCSGLASGYLYLKLAMKW 126 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 3.8 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 153 LFVRHRLVLFSERSYYYLSKIHTGYL-LTNSMKY 55 +F + V+ + R ++Y S + +GYL L +MK+ Sbjct: 93 IFAKGLNVIEANRLFFYCSGLASGYLYLKLAMKW 126 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 3.8 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 153 LFVRHRLVLFSERSYYYLSKIHTGYL-LTNSMKY 55 +F + V+ + R ++Y S + +GYL L +MK+ Sbjct: 93 IFAKGLNVIEANRLFFYCSGLASGYLYLKLAMKW 126 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = +1 Query: 304 LTTSDAKTPSKRTRRTESSLEQESDETPLMEDMIVQDD 417 L ++ TP KR + S QE+D +++ + +++ Sbjct: 837 LNSTPRSTPDKREKSPTSDKAQEADGEVVVKKEVDEEE 874 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 103 SQ*NSHWVPTN 71 SQ N++WVPT+ Sbjct: 804 SQNNTNWVPTS 814 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,997 Number of Sequences: 336 Number of extensions: 1959 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -