BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H07f (455 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CU457740-10|CAM36340.1| 351|Caenorhabditis elegans Hypothetical... 27 4.9 AF016687-1|AAC48094.2| 315|Caenorhabditis elegans Dumpy : short... 27 8.6 >CU457740-10|CAM36340.1| 351|Caenorhabditis elegans Hypothetical protein C50E10.10 protein. Length = 351 Score = 27.5 bits (58), Expect = 4.9 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 65 YSTASSVNISFYVLVTLMT**YRSITVTLT*ILVARNVKLIRDMSHFN 208 YS S+N +FY+++ L + I+ LT ILV + K+I+ HF+ Sbjct: 17 YSLNGSLN-NFYLILAL----FELISYFLTAILVLKTCKIIQKSKHFH 59 >AF016687-1|AAC48094.2| 315|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 9 protein. Length = 315 Score = 26.6 bits (56), Expect = 8.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 449 GTPGFPSHDVVKRRPVNCNTTHYRANWVPGP 357 G PG P K P N T H+ N P P Sbjct: 251 GNPGLPGPQGPKGEPGNPGTCHHCQNRAPAP 281 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,837,732 Number of Sequences: 27780 Number of extensions: 130616 Number of successful extensions: 286 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 809909048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -